Information

Ist mein Verständnis der Bergmannschen Regel richtig? (Masse ist sekundär)

Ist mein Verständnis der Bergmannschen Regel richtig? (Masse ist sekundär)


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Laut Wikipedia gilt die Bergmannsche Regel, weil Tiere, die in kälteren Gebieten leben, ein größeres Verhältnis von Oberfläche zu Volumen haben. Wenn ich das richtig verstehe, liegt der Vorteil der massigeren Körper der Polartiere nicht wirklich in einer größeren Masse, sondern in einer Form, die näher an einer Kugel liegt - was normalerweise eine größere Masse bedeutet.

Habe ich recht?


12.4: Interpretieren von Massenspektren

Bei der Interpretation von Fragmentierungsmustern kann es hilfreich sein zu wissen, dass die schwächsten Kohlenstoff-Kohlenstoff-Bindungen erwartungsgemäß am ehesten brechen. Bei Problemen mit der Interpretation von Massenspektren können Sie sich auf die Tabelle der Bindungsdissoziationsenergien beziehen.

Auf dieser Seite wird erläutert, wie sich Fragmentierungsmuster bilden, wenn organische Moleküle in ein Massenspektrometer eingespeist werden, und wie Sie Informationen aus dem Massenspektrum gewinnen können.


Kennen Sie den Standort der Sicherheitsausrüstung

Für den Fall, dass etwas schief geht, ist es wichtig zu wissen, wo sich die Sicherheitsausrüstung befindet und wie sie verwendet wird. Es ist eine gute Idee, die Ausrüstung regelmäßig zu überprüfen, um sicherzustellen, dass sie in Ordnung ist. Kommt zum Beispiel tatsächlich Wasser aus der Notdusche? Sieht das Wasser in der Augenspülung sauber aus?

Sie sind sich nicht sicher, wo sich die Sicherheitsausrüstung befindet? Überprüfen Sie die Sicherheitszeichen im Labor und suchen Sie danach, bevor Sie mit einem Experiment beginnen.


Wenn eine Lektüre des Korans in die Irre führen kann

Hoch über allem ist dann Gott, der Souverän, der Ultimative Wahrheit ! Und deshalb, Eile nicht mit dem Koran Vor es ist dir vollständig offenbart worden, aber sprich: O mein Erhalter, vergrößere mich an Wissen . 20:114

Ja, der Koran selbst warnt davor, dass ein falsches Lesen des Korans irreführen kann (2:26, ​​3:7, 17:41, 17:45-46, 17:82, 39:23, 56:79, 71:5- 7). Es kann seine Irrleser zumindest in die Irre führen 1 Drei Wege:

Erstens kann eine Lektüre des Korans irreführend sein, wenn wir bestimmte Botschaften aus ihren HISTORISCHEN EINSTELLUNGEN nehmen

Der Koran ist untrennbar mit seinem Kontext und seiner Umgebung verbunden. Es ist ein Erfahrungsbericht eines menschlichen Boten, der an die Araber und die Welt „gesandt“ wurde.

Neben der Übermittlung seiner universellen Botschaften an die gesamte Menschheit aller Zeiten enthält der Koran hauptsächlich Verse, die sich auf bestimmte Themen beziehen, die zu Zeit und Ort seiner Offenbarung gehören. Viele dieser Verse können den Leser verwirren und irreführen, wenn sie nicht in ihrem spezifischen Kontext betrachtet werden. Deshalb ist das Lesen im historischen Kontext wichtig.

Ein gutes Beispiel hierfür ist das viel diskutierte Thema die Schwertverse. Während dieser harten Tage des entstehenden Islam sanktionieren diese Verse einfach die Selbstverteidigung angesichts von Verfolgung und Aggression. Aber zu keinem Zeitpunkt gibt es den geringsten Hinweis darauf, dass Anstiftung zu Gewalt akzeptabel ist. Sowohl Islamophobe als auch Extremisten lesen diese Verse jedoch absichtlich aus dem Kontext, um ihre eigenen Ziele zu fördern, während sie selektiv alle zugehörigen Texte und auch den Rest des Korans ignorieren, der so ständig und so verzweifelt nach Frieden und Ausgeglichenheit ruft.

Nehmen das Gesetzbuch im Koran als weiteres Beispiel. Der Koran hat als Reaktion auf die besonderen Bedürfnisse der Zeit und des Ortes seiner Offenbarung einen Rechtskodex einschließlich eines Strafrechtssystems vorgeschrieben. Dies umfasste angeblich Körper- und Todesstrafen für bestimmte moralische Verbrechen, wie Auspeitschen wegen öffentlich begangener Hurerei und die Todesstrafe für vorsätzliche Tötung. Da sich der inspirierte Bote jedoch damals mit realen Problemen einer bestimmten Sozioökonomie beschäftigte, muss diese spezifische Vorschrift in ihrem zeitlichen Rahmen und nicht als etwas Zeitloses verstanden werden.

Da sich der Koran für eine kontinuierliche, neue Interpretation offen hält, glauben wir nicht, dass diese zeitlichen Elemente als solche den Koran fehlbar machen. In unserer heutigen veränderten Weltsituation kann dieser zeitgebundene Rechtskodex nur rationalisiert werden, wenn er in einen modernen Kodex übersetzt werden kann, der flexibel ist und sich gemäß den sich entwickelnden Bedürfnissen der Gesellschaft weiterentwickeln kann, während er nach der Leitung der Vernunft transzendiert (5 :38-39, 24:2-5, 17:33-36).

Wir können natürlich versuchen, aus diesen spezifischen Gesetzen einige allgemeine Richtlinien und universelle Werte abzuleiten. Aber sie als unveränderlich und für alle Zeiten anwendbar zu betrachten – indem man sie aus ihrer Geschichte und Zeitlinie herausreißt – muss unserer Meinung nach sehr verwirrend und völlig irreführend sein und widerspricht dem rationalen Geist des Korans.

Kurz gesagt, einige der Botschaften und Anweisungen des Korans sind spezifisch und zeitlich begrenzt, während andere allgemein und ewig sind. Oft ist der Unterschied zwischen den beiden unsicher und nebulös. Es bleibt eine Herausforderung für Islamwissenschaftler, genau herauszufinden, welche Botschaft oder welche Anweisung in welche Kategorie fällt.

Hier stoßen wir auf das Problem mit Scharia, wenn es nur ein starres, auf Hadithen basierendes Verständnis des Korans aus dem 7. bis 9. Jahrhundert darstellt. Wenn der Koran nun sagt, dass Gott der ultimative Richter und Gesetzgeber ist (12:40) oder dass die Menschen nach der göttlichen Offenbarung richten sollen (5:44, 45, 47), vermittelt er verschiedene Bedeutungsebenen. Aber es bedeutet nicht automatisch, dass wir all diese zeitgebundenen Regeln und Gesetze von auferlegen müssen Scharia auf unsere aktuelle Realität. Oder dass wir vereinfachend davon ausgehen sollten, dass sie alle von göttlicher Gesetzgebung sind und alle dazu bestimmt sind, zu allen Zeiten und unter allen sozioökonomischen Umständen Wort für Wort angewendet zu werden. Dieses Konzept ist äußerst gefährlich und kann sogar katastrophal werden, wenn es, Gott bewahre, in der Realität angewendet wird.

Jetzt können wir den Koran vielleicht besser verstehen, wenn wir die ungefähre Zeit und die Region, auf die er sich bezieht, wirklich besser verstehen können, einschließlich der Menschen und der beteiligten sozioökonomischen Faktoren. Studien in Bereichen wie Geschichte (inkl. marxistische Analyse historischer Dialektik), Archäologie, Soziologie, vergleichende Sprachwissenschaft usw., die sich mit der Entstehung und Entwicklung des Islam befassen, können in dieser Hinsicht hilfreich sein. Obwohl viel Forschung betrieben wurde, ist mehr erforderlich, um mehr Licht in diese Umgebung zu werfen und diese damit verbundenen Ereignisse zu entmystifizieren. In dieser Hinsicht fanden wir beispielsweise „Der Ursprung und die Entwicklung des Islam: Ein Essay über sein sozioökonomisches Wachstum von Asghar Ali Engineer“ einen unschätzbaren Versuch.

Obwohl wir trotz aller Versuche möglicherweise nie in der Lage sein werden, unser Verständnis der historischen Umgebung einer fernen Vergangenheit vollständig zu verstehen oder zu überprüfen – wir müssen es tun zumindest anerkennen dass einige der Botschaften des Korans reale Probleme behandeln, die zu einem bestimmten historischen Kontext gehören und daher nicht ad verbum zeitlos sein sollen. Viele muslimische Geistliche werden, wenn sie dies nicht anerkennen, das Buch weiterhin irgendwie falsch interpretieren und ihre blinden Anhänger irreführen.

Sekunde, eine Lektüre des Korans kann in die Irre führen, wenn wir seine Botschaften nicht GANZHEITLICH lesen

Der Koran klärt sich durch seinen interaktiven Erklärungsprozess, bei dem Verse durch Verse erklärt werden.

Daher müssen Verse innerhalb eines Clusters betrachtet werden und nicht getrennt von allen verwandten Versen. Eine oberflächliche, isolierte Lektüre kann uns oft zu einem falschen Verständnis führen.

Da es somit schwierig ist, einen einzelnen Vers aus seinen Zusammenhängen herauszulösen (2:85), ist es in der Regel schwierig, ihn beispielsweise einer genauen Kategorie wie „wörtlich“ oder „metaphorisch“ zuzuordnen. Aus diesem Grund beginnen sich, wenn wir versuchen, die Texte so ganzheitlich zu lesen, oft „wörtlich“ und „metaphorisch“ zu überlappen, und jedes Mal, wenn miteinander verbundene Lektüre in einem neuen Kontext neue Bedeutungsschichten hervorbringt.

Kein Wunder, dass das Verständnis eines Verses oder eines Textes zu einem bestimmten Zeitpunkt von Leser zu Leser so stark variieren kann, und sogar für denselben Leser zu unterschiedlichen Zeiten, abhängig von dem Kontext, in dem sie sich gerade befindet, sowie von ihrem mentalen Zustand , Einstellung, Wissens- und Erfahrungsstand und andere individuelle Umstände und fraktionelle Hintergründe.

Für unser Studium ist der Koran göttlich und er behauptet zu Recht, keinen Widerspruch in sich zu haben (4:82, 39:23). Doch ihre Interpretationen sind menschlich und sie kämpfen mit ihren endlosen Widersprüchen gegeneinander (18:54).

Ja, der interaktive Prozess der Selbstklärung des Korans erfordert eine ganzheitliche Lektüre (6:105, 20:114). Dies ist jedoch eine äußerst schwierige Aufgabe.

Dies liegt daran, dass die natürlichen Beschränkungen des Geistes, die Wahrheit in ihrer Gesamtheit (oder „Akhirat“) zu erfassen, „eine unsichtbare Barriere“ zwischen dem Koran und seinem menschlichen Verständnis hinterlassen (17:45-46). Dieses Hindernis, das in unterschiedlichen Ansichten variiert, zerschmettert das „eine göttliche Licht“ („die Wahrheit“ 24:35, 20:114) in „viele menschliche Farben“ („Teilwahrheiten“ 35:19-28, 30:9-24 .). , 16:2-69, 39:18-69, 2:22-87, 2:136-164, 23:17-32).

Anscheinend gibt es im Koran aus der Perspektive des Göttlichen keinen Widerspruch. Aber wenn es um die Perspektiven der Menschen geht, scheinen die wahrgenommenen Widersprüche endlos zu sein. Und dies liegt zum Teil an der Verbundenheit des Korans, die durch ein komplexes Netzwerk interaktiv ist, und der angeborenen Unbestimmtheit eines großen Teils davon, die unterschiedlich von verschiedenen Geistern wahrgenommen wird, die alle in ihren Empfängern begrenzt sind.

Auf diese Weise ermöglichte zum Beispiel eine distanzierte Lesart von 4:34 mit einer bewussten Fehlinterpretation des mehrfach bedeutungsvollen Verbs „daraba“ der patriarchalischen Gesellschaft, den Koran zu missbrauchen, um die männliche Arroganz ihrer Frauenschläger aufrechtzuerhalten. Und erlaubte der Dreistigkeit eines so renommierten Kommentators wie Ibn Kathir zu behaupten, dass „ein Mann nicht gefragt werden darf, warum er seine Frau geschlagen hat“.

Ebenso trug ein isoliertes Verständnis zB der missverstandenen Anweisung wie „Gehorche Gott und gehorche dem Boten (64:12)“ oder „Also nimm an, was der Bote dir gibt, und unterlasse, was er dir verbietet (59:7)“ bei zur Erfindung des Hadith. Ähnliche distanzierte, voreingenommene Lesarten einiger weniger unausgesprochener Verse des Korans, unterstützt durch widersprüchliche Hadithe, trugen zur Bildung von Sekten bei.

Dritter, eine Lektüre des Korans kann in die Irre führen, wenn wir die nicht wörtlichen Botschaften Wörtlich lesen

Ein großer Teil des Korans ist verschleiert und vage.

Abgesehen von klaren Botschaften enthält der Koran auch Botschaften mit mehreren Bedeutungen (3:7). Auf die eine oder andere Weise neigen diese Botschaften dazu, unklar, vage, ungenau, indirekt, nicht wörtlich, mehrdeutig, allegorisch, figurativ und so weiter zu sein.

Hier ist die Logik dahinter. Um tiefere, komplexe und abstrakte Ideen zu präsentieren, spricht der Koran – eine gereimte Prosa, die ursprünglich für lyrische Rezitation und leichteres Auswendiglernen gedacht war (36:69-70) – oft in einer unnachahmlichen Sprache, die eine Reihe literarischer Mittel einschließlich Symbolen verwendet , Idiome, Gleichnisse, Metaphern, Allegorien, Geschichten, Gleichnisse, Analogien, Anspielungen, Personifikation, Wiederholung, stille Interpolationen, verstreute Kompositionsweise und rhetorische Mittel wie Antithese, Homonymie, Hyperbel, Palindrom, Metonymie, Klammer, grammatikalische Verschiebungen, Chiasmus, Ring Komposition und so weiter, alles innerhalb der Dynamik eines interaktiven selbsterklärenden Prozesses.

Es ist diese sehr einzigartige literarische Struktur des Korans, die einen beträchtlichen Teil des Korans bewahrt verdeckt und versteckt und, abhängig von den geistigen Fähigkeiten und Einstellungen der Leser, oft schwer zu erfassen (56:77-79). Obwohl diese Schwierigkeit beim Lesen durch den Koran selbst bestätigt wird, wurde uns geraten, Streit über die erwarteten Unstimmigkeiten zu vermeiden (3:7). Aber die meisten von uns scheinen sich nicht für diesen guten Rat zu interessieren, da wir normalerweise sehr stark von unseren eigenen, hart erarbeiteten Interpretationen ausgehen.

Während viele koranische Botschaften so durch nicht wörtliche Texte zum Ausdruck gebracht werden, wird im Koran eindringlich betont, dass wir diese Texte im übertragenen Sinne verstehen, um ihre tatsächliche, tiefere Bedeutung zu erhalten, die unter ihrer wörtlichen Hülle verborgen ist (17:89, 12:111, 15 .). :75, 56:77-79).

Nehmen Sie als Beispiel die koranischen Beschreibungen der metaphysischen Themen wie göttliche Eigenschaften, Auferstehung der Toten, Tag des Gerichts, Paradies und Hölle und so weiter. Während es sich bei diesen Beschreibungen vermutlich um reale Stoffe unbekannter Reiche (al-ghayb) handelt, werden sie im Koran in Form von Allegorien ausgedrückt, da sie sich mit Themen befassen, die jenseits aller Wahrnehmungen und Definitionen unserer gegenwärtigen Existenz liegen (3:7, 2 :24-26, 13:35, 17:60, 47:15, 74:31, 76:16). Zweifellos können hier Leser mit einem literalistischen Ansatz leicht zu einem oberflächlichen, falschen Verständnis gelangen.

Nehmen Sie als weiteres Beispiel die Geschichten im Koran. Der Koran selbst sagt, dass er auf seine Weise viele Gleichnisse der früheren Generationen nacherzählt ('mathal' 24:34, 25:33 vgl. 3:3-7 5:27) – dh alte Mythen, Legenden, Allegorien und Bildungsgeschichten – die hauptsächlich eine Reihe von moralischen Lektionen vermitteln und nicht unbedingt wörtlich als reale oder historische Ereignisse verstanden werden sollen (24:34-35, 25:33, 39:27, 12:111 vgl. 12: 7, 12:111, 15:75, 23:30).

Man könnte argumentieren, dass eine wörtliche Lesart dieser Gleichnisse in gewissem Maße irrational ist, zumindest aus dem Grund, dass sie alle anthropomorph im Ansatz und im Inhalt abgöttisch sind. Wie kann Gott im wahrsten Sinne des Wortes zu Moses sprechen, wenn Gott über all unseren Wahrnehmungen steht?

Oder wie kann ein sanftmütiger, weichherziger Abraham (11:75) – der Patriarch des Islam und ein Vorbild für Muslime – physische Idole einer anderen Religion zerschmettern (und den größten verschonen!, 21:58), in a literarischer Sinn? Verstößt es nicht direkt gegen die klare Anweisung des Korans, keine Götzen anderer zu missbrauchen (6:108)? Und verherrlicht eine wörtliche Lesart eines solchen Berichts nicht Intoleranz und Vandalismus? Und möglicherweise Fanatiker wie Taliban und ISIS dazu anstiften, historische und archäologische Schätze als Symbole einer unheiligen, vorislamischen Vergangenheit zu zerstören? Oder wie kann Gott Abraham im wahrsten Sinne des Wortes bitten, seinen Sohn zu opfern, wenn der Koran alle ungerechten Tötungen und Übertretungen verbietet (5:53, 6:151, 16:90, 2:190)? Reduziert sie den barmherzigen Gott nicht zu einer blutrünstigen, heidnischen Gottheit und führt sie in die Irre, indem sie den heidnischen Brauch des Tieropfers heiligt und in ein übereifriges Massenritual verwandelt?

Da ein wörtliches Verständnis dieser Gleichnisse oft wenig bis null bis minus Sinn macht, kann man daraus schließen, dass es – anstatt sie mechanisch als reale Geschichten zu lesen – wichtig ist, die wahre Einsicht aus ihnen zu gewinnen, indem man versucht, ihre verschleierten, tieferen Dinge zu erfassen , metaphorische Bedeutungen, wie vom Koran selbst angewiesen.

Abschließende Gedanken

Ja, der Koran selbst warnt davor, dass ein falsches Lesen des Korans irreführen kann (2:26, ​​3:7, 17:41, 17:45-46, 17:82, 39:23, 56:79, 71:5- 7). Es kann seine Fehlleser auf mindestens drei Arten in die Irre führen.

Erstens kann es in die Irre führen, wenn wir bestimmte Botschaften des Korans aus ihren HISTORISCHEN EINSTELLUNGEN herausnehmen. Die Schwertverse und das Gesetzbuch im Koran sind mögliche Beispiele.

Zweitens kann eine Lektüre des Korans in die Irre führen, wenn wir seine Botschaften nicht GANZHEITLICH lesen und sie daher innerhalb eines Clusters von Verbindungen nicht verstehen. Es ist, wenn wir in Eile lesen oder unser eigenes Verständnis eines Textes losgelöst von seinem lokalen und Gesamtzusammenhang stark fühlen und so alle Zusammenhänge und alle anderen Interpretationsmöglichkeiten außer Acht lassen. Beispiele sind: falsches Lesen von 4:34, um die Frau zu unterstützen, schlagen, 2:106, um die falsche Doktrin der Aufhebung zu erfinden 64:12 oder 59:7, um Hadith-Hörensagen als göttliche Mitautorität neben dem Koran zu fördern und so weiter.

Drittens kann eine Lektüre des Korans irreführend sein, wenn wir die nicht wörtlichen Botschaften Wörtlich lesen. Die koranischen Beschreibungen der metaphysischen Themen wie Paradies und Hölle und die wiedererzählten Gleichnisse der Alten sind in dieser Hinsicht wichtige Beispiele.

Die Koranbotschaften zu lesen ist wie die komplexen Kunstwerke von MC Escher zu sehen. Besessen von der Darstellung der Unendlichkeit, bestehen sie aus überlappenden, multiplen Bildern, oft mit Tessellation und sich wiederholenden Mustern, die ineinander verschachtelt sind. Manchmal sieht man ein Bild, manchmal ein anderes und dann noch eins, und dann ist man völlig fasziniert zu beobachten, wie sie alle auffallend zusammenarbeiten, indem sie sich gegenseitig beeinflussen, sich in etwas Großes, Größeres und noch Größeres verwandeln. Aus einfachen Stücken gemacht, ja, die zugrunde liegenden Botschaften des Korans sind einfach, aber transzendental, kraftvoll und erhaben schön, vorausgesetzt, sie werden mit einem klaren Verstand und richtigem Verständnis gelesen.

Der Koran gibt Zeichen, Symbole, Hinweise und Orientierungspunkte und überlässt sie der persönlichen Reflexion und Analyse des Lesers. Somit spiegelt der Koran zu einem großen Teil das eigene Antlitz des Lesers wider. Die Leute können darin irgendwie finden, was sie suchen, was sie auf eine höhere Ebene heben oder in die Irre führen kann, je nach persönlicher Verfassung, Einstellung und Absicht.

Aber warum hat Gott den Koran verlassen, um von Leuten, die ihn falsch lesen, missverstanden zu werden, und warum “Er führt viele dadurch in die Irre und führt viele dadurch (2:26)“ ist eine andere Diskussion. In dieser Hinsicht scheint der Koran seine eigene Antwort zu haben: „Aber Er führt dadurch niemals in die Irre, außer die Bösen. 2:26” vgl. 3:7, 17:41, 17:82, 56:79-82.

Die Verzerrung durch Hadith und traditionelle Tafsirs und die Auslegung durch die Bibel sind einige der Haupthindernisse in unserem Verständnis der wahren Botschaften des Korans. Daher ist ein schwerwiegender Grund für unsere Fehlinterpretation des Korans die jahrhundertealte Versteinerung der traditionell akzeptierten „Bedeutungen“ seiner Worte und Überlieferungen – oft durch außerkoranische Quellen und unzuverlässige Sekundärmaterialien. Dies haben wir im Rahmen dieses Artikels ausgelassen, um langwierige Diskussionen zu vermeiden.

Soll der Koran in seinem äußeren Kontext gelesen werden? Dies ist eine schwierige Frage. Einerseits, wenn der äußere Kontext für das Verständnis so wichtig ist, dann ist Gott gegenüber Nicht-Archäologen und Nicht-Historikern nicht fair. Oder die Implikation ist, dass es für jeden obligatorisch ist, etwas Geschichte zu studieren. Betrachten Sie andererseits dieses Gedankenexperiment: Sie sind ein Cyborg-Theologe und denken über die Verse über die menschliche Biologie nach (die über die menschliche Entwicklung, Nahrung, Schlaf, Sex, Ausscheidung usw.), was so etwas wie . ist die ferne Vergangenheit. Dann müssen Sie sich diese ferne Vergangenheit ansehen, um diese Verse zu verstehen. Wir tun bereits, dass wir für den Transport nicht mehr auf Pferde und Kühe angewiesen sind und unser Leben weit weg von der Landwirtschaft ist. Dennoch verstehen wir Verse über Pferde, Kühe und Landwirtschaft durch eine vage Vorstellung davon. Ich denke, eine vage Idee ist genug, keine Spezialkenntnisse erforderlich. Aber was ist, wenn wir eines Tages so aufgerüstet sind, dass wir sogar diese vage Idee verloren haben? Es gibt einige Implikationen.Erstens, wenn der Koran dazu bestimmt ist, die Zeit vollständig zu überschreiten und Technikfeindlichkeit falsch ist, dann bedeutet dies wahrscheinlich, dass der Tag, an dem selbst diese vage Idee verloren geht, niemals kommen wird. Oder diese scheinbar Low-Tech-Dinge, die erwähnt werden, sind in gewisser Weise gut für uns, die wir nicht kennen. Wahrscheinlich haben die Amish und Umweltschützer Recht, wir sollten zur Natur zurückkehren. Zweitens brauchen wir diese vage Idee, und es steht uns frei, uns selbst zu aktualisieren. Nun hängt dieses Problem mit der Debatte zwischen den techno-progressiven und den biokonservativen zusammen. Wenn Transhumanismus richtig ist, muss die Schrift immer mehr metaphorisch gelesen werden. Ich habe nicht gesagt, dass ich ein Transhumanist bin, ich kann nicht entscheiden, ob Transhumanismus wahr ist oder nicht. Was denken Sie?

Ich denke, der Koran ist im Wesentlichen ein Buch der Anleitung. Daher müssen seine grundlegenden, d. h. für unsere Orientierung wichtigen Botschaften per se ganz klar sein. Daher ist der Koran aus der Perspektive seines Kerns wahrscheinlich leicht zu verstehen. Zum Beispiel können wir das islamische Gotteskonzept verstehen, indem wir die 4 Verse von Ch 112 und das islamische Glaubenssystem durch das Lesen von 2:285 lesen. Wir können auch den Islam praktizieren, indem wir 2:177 oder 4:36 oder einfach nur die 3 Verse von Ch 103 befolgen. Wir müssen keinen externen Kontext studieren, um diese zentralen Botschaften zu verstehen.

Gleichzeitig ist der Koran jedoch unendlich tiefgründig, wobei ein beträchtlicher Teil seiner Botschaften scheinbar verschleiert und vage ist und ihre Bedeutung erst allmählich im individuellen und kollektiven menschlichen Geist entfaltet. Hier kann es als notwendig erachtet werden, ein Leben lang mit dem Studium des Buches zu verbringen, um seiner endgültigen Philosophie näher zu kommen. Wissenschaftler können zu viele Themen ausgraben, in denen Diskussionen endlos erscheinen und Streitigkeiten ungelöst bleiben. Wo jede neue Interpretation eine neue Dimension erschließen kann, während unterschiedliche Meinungen zu einem bestimmten Thema tatsächlich zu einem wachsenden Reichtum unserer Wahrnehmung darüber führen können. Darüber hinaus können Hintergrundinformationen oder relevante Informationen zu unserem weiteren Verständnis einer interaktiven Nachricht beitragen.

Nun, viele Kontroversen in der Exegese beziehen sich auf die Tatsache, dass der Koran nicht nur seine universellen Botschaften an die gesamte Menschheit aller Zeiten übermittelt, sondern auch größtenteils Texte enthält, die irgendwie an ihren raum-zeitlichen Kontext und ihre Umgebung gebunden sind. Beispiele: spezifische Wörter (zB salat, siyam, zakat), spezifische Begriffe (zB Baka, Kaba, Qibla, Sabians, Jinn), spezifische Phrasen und Redewendungen (zB 'was deine rechte Hand besaß'), spezifische Konzepte (zB Rituale, Polygamie , Sklaverei, Erbschaft, Riba, Börsenökonomie, Gerechtigkeit, Gleichheit, Menschenrechte, Tierrechte), spezifische Anweisungen (z Justizsystem) usw. Hier ist mein Eindruck, dass wir vielleicht einige der Texte des Korans besser verstehen, wenn wir Zeit und Ort seiner Offenbarung besser verstehen. Studien in Bereichen wie Geschichte, Archäologie, Soziologie, vergleichende Sprachwissenschaft usw. können in dieser Hinsicht hilfreich sein.

Ich stimme Ihrer Schlussfolgerung aus dem Gedankenexperiment mit dem Cyborg-Theologen zu, ja, „eine vage Idee ist genug, kein Spezialwissen erforderlich“, wenn wir versuchen, beispielsweise Verse über Pferde, Kühe und Landwirtschaft zu verstehen. Obwohl es nach unserem derzeitigen Wissensstand unmöglich erscheint, die Frage zu beantworten, ob Transhumanismus wahr ist oder nicht und ob wir eines Tages so hochgerüstet sein werden, dass wir selbst die vage Vorstellung von Pferden, Kühen und Landwirtschaft verloren haben. Wir können uns nur mehrere mögliche Szenarien vorstellen. Einerseits können die Amish und die Umweltschützer in unterschiedlichem Maße Recht behalten. Andererseits kann uns die Technologie so extrem transhumanisieren, dass wir die Schrift hauptsächlich metaphorisch lesen müssen.

Wenn wir für unsere Zeit und unseren Ort neue Regeln und Gesetze erlassen, die sich vom Koran unterscheiden, was bedeutet das dann: Der Koran sagt, dass Gott der ultimative Richter und Gesetzgeber ist (12:40), oder dass die Menschen nach richten sollen die göttliche Offenbarung (5:44, 45, 47)

Mein diesbezügliches Verständnis ähnelt dem von Dr. Asghar Ali Engineer:

„Das Verständnis des Ingenieurs vom Koran als göttlicher Offenbarung basiert auf der Unterscheidung, die er zwischen dem wesentlichen Wertesystem des Textes einerseits und den im Text enthaltenen rechtlichen Verlautbarungen, die er als kontextspezifisch ansieht, andererseits zieht Sonstiges. Während erstere von ewiger Bedeutung sind und somit die Essenz des Korans darstellen, werden letztere als im spezifischen Kontext des Arabiens des 7. . Jede Religion, argumentiert Engineer, muss in einem gegebenen Kontext funktionieren und, indem sie viele der Institutionen und Praktiken dieses Kontexts akzeptiert, versuchen, sie schrittweise zu modifizieren oder zu transzendieren. So sind zum Beispiel die Aussagen des Korans zu Frauen oder Sklaverei im Zusammenhang mit dem Kontext zu sehen, in dem der göttliche Text offenbart wurde.

Obwohl Patriarchat und Sklaverei als gegen den Plan Gottes für die Welt verstoßen angesehen werden, musste der Koran sie akzeptieren, da sie tief im Kontext der Gesellschaft verwurzelt waren, in der sie offenbart wurden. Dies war jedoch keine passive Akzeptanz oder von ganzem Herzen legitimierte Legitimation. Vielmehr habe der Koran versucht, die Härte dieser Institutionen zu modifizieren, und sein grundlegendes Wertesystem, argumentiert Engineer, legt klar nahe, dass Gott will, dass sie im Laufe der Zeit allmählich abgeschafft werden. Mit diesem kontextuellen Ansatz zum Verständnis des Korans versucht Engineer, eine neue Art der Textinterpretation zu entwickeln, die er für unsere Zeit als relevant ansieht.“ (Hermeneutischer Ansatz des Ingenieurs: Eine Kritik).

Und was ist damit:
Aber wie kommt es, dass sie zum Gericht zu euch kommen, während sie die Tora haben, in der Allahs Urteil steht? Dann wenden sie sich [auch] danach ab, aber das sind [eigentlich] keine Gläubigen.
Wahrlich, Wir sandten die Tora herab, in der Führung und Licht waren. Die Propheten, die sich [Allah] unterwarfen, richteten nach ihm für die Juden, wie auch die Rabbiner und Gelehrten nach dem, was ihnen von der Schrift Allahs anvertraut war, und sie waren Zeugen dafür. Also fürchte die Leute nicht, sondern fürchte Mich, und tausche Meine Verse nicht gegen einen geringen Preis ein. Und wer nicht nach dem richtet, was Allah offenbart hat, der sind die Ungläubigen.
Und Wir haben ihnen darin ein Leben um ein Leben, ein Auge um ein Auge, eine Nase um eine Nase, ein Ohr um ein Ohr, ein Zahn um einen Zahn und für Wunden gesetzliche Vergeltung verordnet. Wer aber auf Almosen verzichtet, für den ist es eine Sühne. Und wer nicht nach dem richtet, was Allah offenbart hat, der sind die Übeltäter.
Und Wir sandten, in ihren Fußstapfen folgend, Jesus, den Sohn Marias, der bestätigte, was in der Thora vor ihm kam, und Wir gaben ihm das Evangelium, in dem Führung und Licht waren, und bestätigten, was ihm von der Thora als Führung vorausgegangen war, und Weisung für die Gerechten.
Und das Volk des Evangeliums soll nach dem richten, was Allah darin offenbart hat. Und wer nicht nach dem richtet, was Allah geoffenbart hat, der sind die trotzigen Ungehorsamen

Bezüglich 5:43-48 finde ich, dass die Notizen von Muhammad Asad die Situation gut erklären.

Nach meinem Verständnis ist die göttliche Offenbarung nach dem Koran ein allmählicher und kontinuierlicher Prozess. Durch diesen Prozess hat die Göttlichkeit der Menschheit nach und nach Seinen Willen enthüllt, indem sie im Maß der sozio-intellektuellen Entwicklung der Menschheit eine Dispensation durch eine andere ersetzt und sie in der vollen Botschaft des Korans mit seinen sich ständig entfaltenden Bedeutungen gipfelt:


2.1 Atome, Isotope, Ionen und Moleküle: die Bausteine

Am Ende dieses Abschnitts können Sie Folgendes tun:

  • Materie und Elemente definieren
  • Beschreiben Sie die Wechselbeziehung zwischen Protonen, Neutronen und Elektronen
  • Vergleichen Sie die Möglichkeiten, wie Elektronen abgegeben oder zwischen Atomen geteilt werden können
  • Erklären Sie, wie sich natürlich vorkommende Elemente kombinieren, um Moleküle, Zellen, Gewebe, Organsysteme und Organismen zu bilden

Auf seiner grundlegendsten Ebene besteht das Leben aus Materie. Materie ist jede Substanz, die Raum einnimmt und Masse hat. Elemente sind einzigartige Formen von Materie mit spezifischen chemischen und physikalischen Eigenschaften, die durch gewöhnliche chemische Reaktionen nicht in kleinere Substanzen zerlegt werden können. Es gibt 118 Elemente, aber nur 98 kommen natürlich vor. Die restlichen Elemente sind instabil und erfordern, dass Wissenschaftler sie in Labors synthetisieren.

Jedes Element wird durch sein chemisches Symbol bezeichnet, das ein einzelner Großbuchstabe oder, wenn der erste Buchstabe bereits von einem anderen Element „eingenommen“ ist, eine Kombination aus zwei Buchstaben ist. Einige Elemente folgen dem englischen Begriff für das Element, wie C für Kohlenstoff und Ca für Kalzium. Die chemischen Symbole anderer Elemente leiten sich von ihren lateinischen Namen ab. Das Symbol für Natrium ist beispielsweise Na und bezieht sich auf Natrium, das lateinische Wort für Natrium.

Die vier Elemente, die allen lebenden Organismen gemeinsam sind, sind Sauerstoff (O), Kohlenstoff (C), Wasserstoff (H) und Stickstoff (N). In der unbelebten Welt kommen Elemente in unterschiedlichen Anteilen vor, und einige Elemente, die bei lebenden Organismen vorkommen, sind auf der Erde insgesamt relativ selten, wie Tabelle 2.1 zeigt. So ist beispielsweise die Atmosphäre reich an Stickstoff und Sauerstoff, enthält aber wenig Kohlenstoff und Wasserstoff, während die Erdkruste, obwohl sie Sauerstoff und eine geringe Menge Wasserstoff enthält, wenig Stickstoff und Kohlenstoff enthält. Trotz ihres unterschiedlichen Vorkommens gehorchen alle Elemente und die chemischen Reaktionen zwischen ihnen den gleichen chemischen und physikalischen Gesetzen, unabhängig davon, ob sie Teil der belebten oder unbelebten Welt sind.

Element Leben (Menschen) Atmosphäre Erdkruste
Sauerstoff (O) 65% 21% 46%
Kohlenstoff (C) 18% verfolgen verfolgen
Wasserstoff (H) 10% verfolgen 0.1%
Stickstoff (N) 3% 78% verfolgen

Die Struktur des Atoms

Um zu verstehen, wie Elemente zusammenkommen, müssen wir zuerst die kleinste Komponente oder den kleinsten Baustein des Elements besprechen, das Atom. Ein Atom ist die kleinste Einheit der Materie, die alle chemischen Eigenschaften des Elements behält. Zum Beispiel hat ein Goldatom alle Eigenschaften von Gold, wie seine chemische Reaktivität. Eine Goldmünze ist einfach eine sehr große Anzahl von Goldatomen, die in die Form einer Münze geformt wurden und kleine Mengen anderer Elemente enthalten, die als Verunreinigungen bekannt sind. Wir können Goldatome nicht in kleinere Teile zerlegen, während wir die Eigenschaften von Gold beibehalten.

Ein Atom besteht aus zwei Regionen: dem Kern, der sich im Zentrum des Atoms befindet und Protonen und Neutronen enthält. Die äußerste Region des Atoms hält seine Elektronen auf der Umlaufbahn um den Kern, wie Abbildung 2.2 zeigt. Atome enthalten neben anderen subatomaren Teilchen Protonen, Elektronen und Neutronen. Das häufigste Isotop von Wasserstoff (H) ist die einzige Ausnahme und besteht aus einem Proton und einem Elektron ohne Neutronen.

Protonen und Neutronen haben ungefähr die gleiche Masse, etwa 1,67 × 10 -24 Gramm. Wissenschaftler definieren diese Masse willkürlich als eine atomare Masseneinheit (amu) oder einen Dalton, wie Tabelle 2.2 zeigt. Obwohl sie eine ähnliche Masse haben, unterscheiden sich Protonen und Neutronen in ihrer elektrischen Ladung. Ein Proton ist positiv geladen, während ein Neutron ungeladen ist. Daher trägt die Anzahl der Neutronen in einem Atom wesentlich zu seiner Masse, aber nicht zu seiner Ladung bei. Elektronen haben eine viel geringere Masse als Protonen und wiegen nur 9,11 × 10 -28 Gramm oder etwa 1/1800 einer atomaren Masseneinheit. Daher tragen sie nicht viel zur gesamten Atommasse eines Elements bei. Daher ist es bei der Betrachtung der Atommasse üblich, die Masse aller Elektronen zu ignorieren und die Masse des Atoms allein aus der Anzahl der Protonen und Neutronen zu berechnen. Obwohl sie keinen wesentlichen Beitrag zur Masse leisten, tragen Elektronen stark zur Ladung des Atoms bei, da jedes Elektron eine negative Ladung hat, die der positiven Ladung des Protons entspricht. In ungeladenen, neutralen Atomen ist die Zahl der Elektronen, die den Kern umkreisen, gleich der Zahl der Protonen im Kern. In diesen Atomen heben sich die positiven und negativen Ladungen gegenseitig auf, was zu einem Atom ohne Nettoladung führt.

Berücksichtigt man die Größe von Protonen, Neutronen und Elektronen, ist der größte Teil des Atomvolumens – mehr als 99 Prozent – ​​leerer Raum. Bei all diesem leeren Raum könnte man sich fragen, warum sogenannte feste Objekte nicht einfach durcheinander hindurchgehen. Der Grund dafür ist, dass die Elektronen, die alle Atome umgeben, negativ geladen sind und sich negative Ladungen gegenseitig abstoßen.

Ordnungszahl und Masse

Atome jedes Elements enthalten eine charakteristische Anzahl von Protonen und Elektronen. Die Anzahl der Protonen bestimmt die Ordnungszahl eines Elements, mit der Wissenschaftler ein Element von einem anderen unterscheiden. Die Anzahl der Neutronen ist variabel, was zu Isotopen führt, bei denen es sich um verschiedene Formen desselben Atoms handelt, die sich nur in der Anzahl der Neutronen unterscheiden, die sie besitzen. Die Anzahl der Protonen und Neutronen zusammen bestimmt die Massenzahl eines Elements, wie Abbildung 2.3 veranschaulicht. Beachten Sie, dass wir den geringen Massebeitrag der Elektronen bei der Berechnung der Massenzahl vernachlässigen. Wir können diese Näherung der Masse verwenden, um leicht zu berechnen, wie viele Neutronen ein Element hat, indem wir einfach die Anzahl der Protonen von der Massenzahl abziehen. Da die Isotope eines Elements leicht unterschiedliche Massenzahlen haben, bestimmen Wissenschaftler auch die Atommasse, die der berechnete Mittelwert der Massenzahl seiner natürlich vorkommenden Isotope ist. Oft enthält die resultierende Zahl einen Bruch. Zum Beispiel beträgt die Atommasse von Chlor (Cl) 35,45, weil Chlor aus mehreren Isotopen besteht, einige (die Mehrheit) mit der Atommasse 35 (17 Protonen und 18 Neutronen) und einige mit der Atommasse 37 (17 Protonen und 20 Neutronen). .

Visuelle Verbindung

Wie viele Neutronen haben Kohlenstoff-12 bzw. Kohlenstoff-13?

Isotope

Isotope sind verschiedene Formen eines Elements mit der gleichen Anzahl von Protonen, aber einer unterschiedlichen Anzahl von Neutronen. Einige Elemente – wie Kohlenstoff, Kalium und Uran – haben natürlich vorkommende Isotope. Kohlenstoff-12 enthält sechs Protonen, sechs Neutronen und sechs Elektronen, daher hat es eine Massenzahl von 12 (sechs Protonen und sechs Neutronen). Kohlenstoff-14 enthält sechs Protonen, acht Neutronen und sechs Elektronen, seine Atommasse beträgt 14 (sechs Protonen und acht Neutronen). Diese beiden alternativen Kohlenstoffformen sind Isotope. Einige Isotope können Neutronen, Protonen und Elektronen emittieren und eine stabilere Atomkonfiguration (niedrigeres Niveau der potentiellen Energie) erreichen. Dies sind radioaktive Isotope oder Radioisotope. Der radioaktive Zerfall (Kohlenstoff-14, der schließlich zu Stickstoff-14 zerfällt) beschreibt den Energieverlust, der auftritt, wenn der Kern eines instabilen Atoms Strahlung freisetzt.

Evolution-Verbindung

Kohlenstoff-Dating

Kohlenstoff ist in der Atmosphäre normalerweise in Form von gasförmigen Verbindungen wie Kohlendioxid und Methan vorhanden. Kohlenstoff-14 (14 C) ist ein natürlich vorkommendes Radioisotop, das in der Atmosphäre aus atmosphärischem 14 N (Stickstoff) durch die Zugabe eines Neutrons und den Verlust eines Protons durch kosmische Strahlung erzeugt wird. Dies ist ein kontinuierlicher Prozess, daher wird immer mehr 14 C erzeugt. Da ein lebender Organismus 14 C zunächst als bei der Photosynthese fixiertes Kohlendioxid aufnimmt, entspricht die relative Menge von 14 C in seinem Körper der Konzentration von 14 C in der Atmosphäre. Wenn ein Organismus stirbt, nimmt er kein 14 C mehr auf, so dass das Verhältnis zwischen 14 C und 12 C abnimmt, da 14 C durch einen Prozess namens Beta-Zerfall allmählich zu 14 N zerfällt – Elektronen- oder Positronenemission. Dieser Zerfall emittiert Energie in einem langsamen Prozess.

Nach etwa 5.730 Jahren wandelt sich die Hälfte der Ausgangskonzentration von 14 C wieder in 14 N um. Die Zeit, die es braucht, bis die Hälfte der ursprünglichen Konzentration eines Isotops wieder in seine stabilere Form zerfällt, nennen wir Halbwertszeit. Weil die Halbwertszeit von 14 C lang ist, nutzen Wissenschaftler es bis dato früher lebende Objekte wie alte Knochen oder Holz. Vergleicht man das Verhältnis der 14 C-Konzentration in einem Objekt zur 14 C-Menge in der Atmosphäre, kann man die Menge des Isotops bestimmen, die noch nicht zerfallen ist. Anhand dieser Menge zeigt Abbildung 2.4, dass wir das Alter des Materials, beispielsweise des Zwergmammuts, genau berechnen können, wenn es nicht viel älter als etwa 50.000 Jahre ist. Andere Elemente haben Isotope mit unterschiedlichen Halbwertszeiten. 40 K (Kalium-40) hat beispielsweise eine Halbwertszeit von 1,25 Milliarden Jahren und 235 U (Uran 235) hat eine Halbwertszeit von etwa 700 Millionen Jahren. Mithilfe der radiometrischen Datierung können Wissenschaftler das Alter von Fossilien oder anderen Überresten ausgestorbener Organismen untersuchen, um zu verstehen, wie sich Organismen aus früheren Arten entwickelt haben.

Link zum Lernen

Um mehr über Atome und Isotope zu erfahren und wie man ein Isotop von einem anderen unterscheidet, führen Sie die Simulation aus.

Das Periodensystem

Das Periodensystem organisiert und zeigt verschiedene Elemente an. Die Tabelle wurde 1869 vom russischen Chemiker Dmitri Mendeleev (1834–1907) entwickelt und gruppiert Elemente, die zwar einzigartig sind, aber bestimmte chemische Eigenschaften mit anderen Elementen teilen. Die Eigenschaften von Elementen sind für ihren physikalischen Zustand bei Raumtemperatur verantwortlich: Sie können Gase, Feststoffe oder Flüssigkeiten sein. Elemente haben auch eine spezifische chemische Reaktivität, die Fähigkeit, sich zu verbinden und chemisch miteinander zu verbinden.

Im Periodensystem in Abbildung 2.5 sind die Elemente nach ihrer Ordnungszahl organisiert und angezeigt und in einer Reihe von Reihen und Spalten auf der Grundlage gemeinsamer chemischer und physikalischer Eigenschaften angeordnet. Neben der Ordnungszahl für jedes Element zeigt das Periodensystem auch die Atommasse des Elements an. Betrachtet man beispielsweise Kohlenstoff, erscheinen sein Symbol (C) und sein Name sowie seine Ordnungszahl sechs (in der oberen linken Ecke) und seine Atommasse von 12.01.

Das Periodensystem gruppiert Elemente nach chemischen Eigenschaften. Wissenschaftler gründen die Unterschiede in der chemischen Reaktivität zwischen den Elementen auf der Anzahl und der räumlichen Verteilung der Elektronen eines Atoms. Atome, die chemisch reagieren und sich aneinander binden, bilden Moleküle. Moleküle sind einfach zwei oder mehr Atome, die chemisch miteinander verbunden sind. Wenn sich zwei Atome chemisch zu einem Molekül verbinden, kommen ihre Elektronen, die den äußersten Bereich jedes Atoms bilden, logischerweise zuerst zusammen, wenn die Atome eine chemische Bindung eingehen.

Elektronenhüllen und das Bohr-Modell

Beachten Sie, dass es einen Zusammenhang zwischen der Anzahl der Protonen in einem Element, der Ordnungszahl, die ein Element von einem anderen unterscheidet, und der Anzahl seiner Elektronen gibt. In allen elektrisch neutralen Atomen ist die Anzahl der Elektronen gleich der Anzahl der Protonen. Somit hat jedes Element, zumindest wenn es elektrisch neutral ist, eine charakteristische Anzahl von Elektronen, die seiner Ordnungszahl entspricht.

1913 entwickelte der dänische Wissenschaftler Niels Bohr (1885–1962) ein frühes Atommodell.Das Bohr-Modell zeigt das Atom als zentralen Kern, der Protonen und Neutronen enthält, wobei die Elektronen in kreisförmigen Orbitalen in bestimmten Abständen vom Kern angeordnet sind, wie Abbildung 2.6 illustriert. Diese Bahnen bilden Elektronenschalen oder Energieniveaus, die eine Möglichkeit darstellen, die Anzahl der Elektronen in den äußersten Schalen zu visualisieren. Diese Energieniveaus werden durch eine Zahl und das Symbol „n“ gekennzeichnet. 1n stellt beispielsweise das erste Energieniveau dar, das dem Kern am nächsten liegt.

Elektronen füllen Orbitale in einer konsistenten Reihenfolge: Sie füllen zuerst die Orbitale, die dem Kern am nächsten sind, dann füllen sie Orbitale mit zunehmender Energie weiter vom Kern entfernt. Wenn es mehrere Orbitale gleicher Energie gibt, füllen sie sich in jedem Energieniveau mit einem Elektron, bevor ein zweites Elektron hinzugefügt wird. Die Elektronen des äußersten Energieniveaus bestimmen die energetische Stabilität des Atoms und seine Tendenz, chemische Bindungen mit anderen Atomen zu bilden, um Moleküle zu bilden.

Unter Standardbedingungen füllen Atome zuerst die inneren Schalen, was oft zu einer unterschiedlichen Anzahl von Elektronen in der äußersten Schale führt. Die innerste Schale hat maximal zwei Elektronen, aber die nächsten beiden Elektronenschalen können jeweils maximal acht Elektronen haben. Dies ist als Oktettregel bekannt, die besagt, dass Atome mit Ausnahme der innersten Schale energetisch stabiler sind, wenn sie acht Elektronen in ihrer Valenzschale, der äußersten Elektronenschale, haben. Abbildung 2.7 zeigt Beispiele einiger neutraler Atome und ihrer Elektronenkonfigurationen. Beachten Sie, dass Helium in Abbildung 2.7 eine vollständige äußere Elektronenhülle hat, in der zwei Elektronen seine erste und einzige Hülle füllen. In ähnlicher Weise hat Neon eine vollständige äußere 2n-Schale, die acht Elektronen enthält. Im Gegensatz dazu haben Chlor und Natrium sieben bzw. eins in ihrer äußeren Hülle, aber theoretisch wären sie energetisch stabiler, wenn sie der Oktettregel folgen würden und acht hätten.

Visuelle Verbindung

Ein Atom kann einem anderen Atom Elektronen geben, nehmen oder mit diesem teilen, um eine vollständige Valenzschale, die stabilste Elektronenkonfiguration, zu erreichen. Betrachtet man diese Abbildung, wie viele Elektronen müssen Elemente der Gruppe 1 verlieren, um eine stabile Elektronenkonfiguration zu erreichen? Wie viele Elektronen müssen die Elemente der Gruppen 14 und 17 aufnehmen, um eine stabile Konfiguration zu erreichen?

Zu verstehen, dass die Organisation des Periodensystems auf der Gesamtzahl der Protonen (und Elektronen) basiert, hilft uns zu wissen, wie sich Elektronen zwischen den Schalen verteilen. Das Periodensystem ist in Spalten und Zeilen basierend auf der Anzahl der Elektronen und ihrer Position angeordnet. Untersuchen Sie einige der Elemente in der Spalte ganz rechts der Tabelle in Abbildung 2.5 genauer. Die Atome der Gruppe 18 Helium (He), Neon (Ne) und Argon (Ar) haben alle äußere Elektronenhüllen gefüllt, was es für sie unnötig macht, Elektronen mit anderen Atomen zu teilen, um Stabilität zu erreichen. Sie sind als einzelne Atome sehr stabil. Da sie nicht reaktiv sind, bezeichnen Wissenschaftler sie als inerte (oder Edelgase). Vergleichen Sie dies mit den Elementen der Gruppe 1 in der linken Spalte. Diese Elemente, einschließlich Wasserstoff (H), Lithium (Li) und Natrium (Na), haben alle ein Elektron in ihrer äußersten Schale. Das bedeutet, dass sie eine stabile Konfiguration und eine gefüllte äußere Hülle erreichen können, indem sie ein Elektron mit einem anderen Atom oder einem Molekül wie Wasser abgeben oder teilen. Wasserstoff wird sein Elektron abgeben oder teilen, um diese Konfiguration zu erreichen, während Lithium und Natrium ihr Elektron abgeben, um stabil zu werden. Durch den Verlust eines negativ geladenen Elektrons werden sie zu positiv geladenen Ionen. Elemente der Gruppe 17, einschließlich Fluor und Chlor, haben sieben Elektronen in ihren äußersten Schalen, daher neigen sie dazu, diese Schale mit einem Elektron von anderen Atomen oder Molekülen zu füllen, was sie zu negativ geladenen Ionen macht. Elemente der Gruppe 14, von denen Kohlenstoff das wichtigste für lebende Systeme ist, haben vier Elektronen in ihrer äußeren Schale, die es ihnen ermöglichen, mehrere kovalente Bindungen (siehe unten) mit anderen Atomen einzugehen. Somit repräsentieren die Spalten des Periodensystems den potentiellen gemeinsamen Zustand der äußeren Elektronenschalen dieser Elemente, der für ihre ähnlichen chemischen Eigenschaften verantwortlich ist.

Elektronenorbitale

Obwohl es nützlich ist, die Reaktivität und chemische Bindung bestimmter Elemente zu erklären, spiegelt das Bohr-Modell nicht genau wider, wie sich Elektronen räumlich um den Kern verteilen. Sie umkreisen den Kern nicht wie die Erde die Sonne, sondern wir finden sie in Elektronenorbitalen. Diese relativ komplexen Formen resultieren daraus, dass sich Elektronen nicht nur wie Teilchen, sondern auch wie Wellen verhalten. Mathematische Gleichungen aus der Quantenmechanik, die Wissenschaftler Wellenfunktionen nennen, können mit einer gewissen Wahrscheinlichkeit vorhersagen, wo sich ein Elektron zu einem bestimmten Zeitpunkt befinden könnte. Wissenschaftler nennen den Bereich, in dem sich ein Elektron am wahrscheinlichsten befindet, sein Orbital.

Denken Sie daran, dass das Bohr-Modell die Elektronenschalenkonfiguration eines Atoms abbildet. Innerhalb jeder Elektronenschale befinden sich Unterschalen, und jede Unterschale hat eine bestimmte Anzahl von Orbitalen, die Elektronen enthalten. Obwohl es unmöglich ist, den Standort eines Elektrons genau zu berechnen, wissen Wissenschaftler, dass es sich höchstwahrscheinlich innerhalb seiner Umlaufbahn befindet. Die Buchstaben, P, D, und F benennen die Unterschalen. Die S Unterschale ist kugelförmig und hat ein Orbital. Die Hauptschale 1n hat nur eine einzige S Orbital, das zwei Elektronen aufnehmen kann. Hauptschale 2n hat eins S und ein P Unterschale und kann insgesamt acht Elektronen aufnehmen. Die P Unterschale hat drei hantelförmige Orbitale, wie Abbildung 2.8 zeigt. Unterschalen D und F haben komplexere Formen und enthalten fünf bzw. sieben Orbitale. Diese zeigen wir in der Abbildung nicht. Hauptschale 3n hat S, P, und D Unterschalen und kann 18 Elektronen aufnehmen. Hauptschale 4n hat S, P, D und F Orbitale und kann 32 Elektronen aufnehmen. Wenn man sich vom Kern wegbewegt, nimmt die Anzahl der Elektronen und Orbitale in den Energieniveaus zu. Wenn wir im Periodensystem von einem Atom zum nächsten fortschreiten, können wir die Elektronenstruktur bestimmen, indem wir ein zusätzliches Elektron in das nächste verfügbare Orbital einpassen.

Das dem Kern am nächsten liegende Orbital, das 1s-Orbital, kann bis zu zwei Elektronen aufnehmen. Dieses Orbital entspricht der innersten Elektronenschale des Bohrschen Modells. Wissenschaftler nennen es die 1S Orbital, weil es um den Kern kugelförmig ist. Die 1S Orbital ist das dem Kern am nächsten gelegene Orbital und wird immer zuerst gefüllt, bevor sich jedes andere Orbital füllt. Wasserstoff hat ein Elektron, daher nimmt er nur einen Platz innerhalb der 1 . einS orbital. Wir bezeichnen dies als 1S 1 , wobei sich die hochgestellte 1 auf das eine Elektron innerhalb der 1 . beziehtS orbital. Helium hat zwei Elektronen, daher kann es die 1 . vollständig füllenS Orbital mit seinen beiden Elektronen. Wir bezeichnen dies als 1S 2 , bezogen auf die beiden Heliumelektronen im 1S orbital. Im Periodensystem Abbildung 2.5 sind Wasserstoff und Helium die einzigen beiden Elemente in der ersten Reihe (Periode). Dies liegt daran, dass sie nur in ihrer ersten Schale, der 1 .-Schale, Elektronen habenS orbital. Wasserstoff und Helium sind die einzigen beiden Elemente, die die 1 . habenS und keine anderen Elektronenorbitale im elektrisch neutralen Zustand.

Die zweite Elektronenschale kann acht Elektronen enthalten. Diese Schale enthält eine weitere Kugel S Orbital und drei „Hantel“ geformt P Orbitale, die jeweils zwei Elektronen aufnehmen können, wie Abbildung 2.8 zeigt. Nach dem 1S Orbital füllt sich, die zweite Elektronenschale füllt sich und füllt zuerst ihre 2S Orbital und dann seine drei P Orbitale. Beim Befüllen P Orbitale, jedes nimmt ein einzelnes Elektron auf. Jeweils einmal P Orbital hat ein Elektron, es kann ein zweites hinzufügen. Lithium (Li) enthält drei Elektronen, die die erste und zweite Schale besetzen. Zwei Elektronen füllen die 1S Orbital, und das dritte Elektron füllt dann die 2S orbital. Seine Elektronenkonfiguration ist 1S 2 2S 1. Neon (Ne) hat alternativ insgesamt zehn Elektronen: zwei befinden sich in seinem innersten 1S Orbital und acht füllen seine zweite Schale (jeweils zwei in der 2S und drei P Orbitale). Somit ist es ein Inertgas und als einzelnes Atom energetisch stabil, das selten eine chemische Bindung mit anderen Atomen eingehen wird. Größere Elemente haben zusätzliche Orbitale, die die dritte Elektronenschale bilden. Während die Konzepte von Elektronenhüllen und Orbitalen eng miteinander verbunden sind, liefern Orbitale eine genauere Darstellung der Elektronenkonfiguration eines Atoms, da das Orbitalmodell die unterschiedlichen Formen und speziellen Ausrichtungen aller Orte angibt, die Elektronen einnehmen können.

Link zum Lernen

Sehen Sie sich diese visuelle Animation an, um die räumliche Anordnung der p- und s-Orbitale zu sehen.

Chemische Reaktionen und Moleküle

Alle Elemente sind am stabilsten, wenn ihre äußerste Schale nach der Oktettregel mit Elektronen gefüllt ist. Dies liegt daran, dass Atome in dieser Konfiguration energetisch günstig sind und sie stabil machen. Da jedoch nicht alle Elemente über genügend Elektronen verfügen, um ihre äußersten Schalen zu füllen, gehen Atome chemische Bindungen mit anderen Atomen ein und erhalten so die Elektronen, die sie für eine stabile Elektronenkonfiguration benötigen. Wenn zwei oder mehr Atome chemisch miteinander verbunden sind, ist die resultierende chemische Struktur ein Molekül. Das bekannte Wassermolekül H2O, besteht aus zwei Wasserstoffatomen und einem Sauerstoffatom. Diese verbinden sich zu Wasser, wie Abbildung 2.9 zeigt. Atome können Moleküle bilden, indem sie Elektronen abgeben, annehmen oder teilen, um ihre äußere Hülle zu füllen.

Chemische Reaktionen treten auf, wenn sich zwei oder mehr Atome zu Molekülen verbinden oder wenn gebundene Atome auseinanderbrechen. Wissenschaftler nennen die Stoffe, die am Anfang einer chemischen Reaktion verwendet werden, Reaktanten (normalerweise auf der linken Seite einer chemischen Gleichung), und wir nennen die Substanzen am Ende der Reaktion Produkte (normalerweise auf der rechten Seite einer chemischen Gleichung). Normalerweise zeichnen wir einen Pfeil zwischen den Reaktanten und Produkten, um die Richtung der chemischen Reaktion anzuzeigen. Diese Richtung ist nicht immer eine „Einbahnstraße“. Um das obige Wassermolekül zu erzeugen, wäre die chemische Gleichung:

Ein Beispiel für eine einfache chemische Reaktion ist der Abbau von Wasserstoffperoxidmolekülen, die jeweils aus zwei Wasserstoffatomen bestehen, die an zwei Sauerstoffatome (H2Ö2). Der Reaktant Wasserstoffperoxid zerfällt zu Wasser, das ein Sauerstoffatom an zwei Wasserstoffatome (H2O) und Sauerstoff, der aus zwei gebundenen Sauerstoffatomen (O2). In der folgenden Gleichung umfasst die Reaktion zwei Wasserstoffperoxidmoleküle und zwei Wassermoleküle. Dies ist ein Beispiel für eine ausgewogene chemische Gleichung, bei der die Anzahl der Atome jedes Elements auf jeder Seite der Gleichung gleich ist. Nach dem Gesetz der Erhaltung der Materie sollte die Anzahl der Atome vor und nach einer chemischen Reaktion gleich sein, so dass unter normalen Umständen keine Atome erzeugt oder zerstört werden.

Obwohl alle Reaktanten und Produkte dieser Reaktion Moleküle sind (jedes Atom bleibt an mindestens ein anderes Atom gebunden), sind bei dieser Reaktion nur Wasserstoffperoxid und Wasser Vertreter von Verbindungen: Sie enthalten Atome von mehr als einer Elementart. Molekularer Sauerstoff hingegen besteht, wie Abbildung 2.10 zeigt, aus zwei doppelt gebundenen Sauerstoffatomen und wird nicht als Verbindung, sondern als homonukleares Molekül klassifiziert.

Einige chemische Reaktionen, wie die obige, können in eine Richtung ablaufen, bis sie alle Reaktanten verbraucht haben. Die Gleichungen, die diese Reaktionen beschreiben, enthalten einen unidirektionalen Pfeil und sind irreversibel. Reversible Reaktionen sind solche, die in beide Richtungen gehen können. Bei reversiblen Reaktionen werden Reaktanten zu Produkten, aber wenn die Konzentration des Produkts einen bestimmten Schwellenwert (charakteristisch für die jeweilige Reaktion) überschreitet, wandeln sich einige dieser Produkte wieder in Reaktanten um. An diesem Punkt kehren sich die Produkt- und Eduktbezeichnungen um. Dieses Hin und Her setzt sich fort, bis ein gewisses relatives Gleichgewicht zwischen Reaktanten und Produkten eintritt – ein Zustand, der Gleichgewicht genannt wird. Eine chemische Gleichung mit einem Doppelpfeil, der sowohl auf die Reaktanten als auch auf die Produkte zeigt, kennzeichnet häufig diese reversiblen Reaktionssituationen.

Im menschlichen Blut beispielsweise binden überschüssige Wasserstoffionen (H + ) an Bicarbonationen (HCO3 - ) Bildung eines Gleichgewichtszustandes mit Kohlensäure (H2CO3). Wenn wir diesem System Kohlensäure zufügen, würde sich ein Teil davon in Bicarbonat- und Wasserstoffionen umwandeln.

Jedoch erreichen biologische Reaktionen selten ein Gleichgewicht, weil sich die Konzentrationen der Reaktanten oder Produkte oder beides ständig ändern, wobei oft das Produkt einer Reaktion ein Reaktant für eine andere ist. Um auf das Beispiel überschüssiger Wasserstoffionen im Blut zurückzukommen, wird die Bildung von Kohlensäure die Hauptrichtung der Reaktion sein. Die Kohlensäure kann den Körper jedoch auch als Kohlendioxidgas (durch Ausatmen) verlassen, anstatt sich wieder in Bicarbonat-Ionen umzuwandeln, und treibt so die Reaktion nach dem Massenwirkungsgesetz nach rechts. Diese Reaktionen sind wichtig für die Aufrechterhaltung der Homöostase in unserem Blut.

Ionen und ionische Bindungen

Einige Atome sind stabiler, wenn sie ein Elektron (oder möglicherweise zwei) aufnehmen oder verlieren und Ionen bilden. Dies füllt ihre äußerste Elektronenhülle und macht sie energetisch stabiler. Da die Anzahl der Elektronen nicht der Anzahl der Protonen entspricht, hat jedes Ion eine Nettoladung. Kationen sind positive Ionen, die durch Elektronenverlust entstehen. Negative Ionen entstehen durch die Aufnahme von Elektronen, die wir Anionen nennen. Wir bezeichnen Anionen mit ihrem Elementarnamen und ändern die Endung in „-ide“, also ist das Anion von Chlor Chlorid und das Anion von Schwefel Sulfid.

Wissenschaftler bezeichnen diese Bewegung von Elektronen von einem Element zum anderen als Elektronentransfer. Wie Abbildung 2.11 zeigt, hat Natrium (Na) nur ein Elektron in seiner äußeren Elektronenhülle. Natrium braucht weniger Energie, um dieses eine Elektron abzugeben, als sieben weitere Elektronen aufzunehmen, um die äußere Hülle zu füllen. Wenn Natrium ein Elektron verliert, hat es jetzt 11 Protonen, 11 Neutronen und nur 10 Elektronen, so dass es eine Gesamtladung von +1 hat. Wir bezeichnen es jetzt als Natriumion. Chlor (Cl) in seinem niedrigsten Energiezustand (dem Grundzustand genannt) hat sieben Elektronen in seiner äußeren Hülle. Auch hier ist es für Chlor energieeffizienter, ein Elektron zu gewinnen, als sieben zu verlieren. Daher neigt es dazu, ein Elektron zu gewinnen, um ein Ion mit 17 Protonen, 17 Neutronen und 18 Elektronen zu erzeugen, was ihm eine negative Nettoladung (-1) verleiht. Wir bezeichnen es jetzt als Chloridion. In diesem Beispiel spendet Natrium sein einziges Elektron, um seine Hülle zu leeren, und Chlor akzeptiert dieses Elektron, um seine Hülle zu füllen. Beide Ionen erfüllen nun die Oktettregel und haben vollständige äußerste Schalen. Da die Anzahl der Elektronen nicht mehr der Anzahl der Protonen entspricht, ist jedes jetzt ein Ion und hat eine Ladung von +1 (Natriumkation) oder –1 (Chloridanion). Beachten Sie, dass diese Transaktionen normalerweise nur gleichzeitig stattfinden können: Damit ein Natriumatom ein Elektron verlieren kann, muss es in Gegenwart eines geeigneten Empfängers wie eines Chloratoms sein.

Ionenbindungen bilden sich zwischen Ionen mit entgegengesetzter Ladung. Zum Beispiel verbinden sich positiv geladene Natriumionen und negativ geladene Chloridionen zu Kristallen aus Natriumchlorid oder Kochsalz, wodurch ein kristallines Molekül ohne Nettoladung entsteht.

Physiologen bezeichnen bestimmte Salze als Elektrolyte (einschließlich Natrium, Kalium und Kalzium), Ionen, die für die Weiterleitung von Nervenimpulsen, Muskelkontraktionen und den Wasserhaushalt notwendig sind. Viele Sportgetränke und Nahrungsergänzungsmittel liefern diese Ionen, um diejenigen zu ersetzen, die der Körper durch das Schwitzen während des Trainings verloren hat.

Kovalente Bindungen und andere Bindungen und Wechselwirkungen

Eine andere Möglichkeit, die Oktettregel zu erfüllen, besteht darin, Elektronen zwischen Atomen zu teilen, um kovalente Bindungen zu bilden. Diese Bindungen sind stärker und viel häufiger als ionische Bindungen in den Molekülen lebender Organismen. Wir finden häufig kovalente Bindungen in organischen Molekülen auf Kohlenstoffbasis, wie unserer DNA und Proteinen. Wir finden auch kovalente Bindungen in anorganischen Molekülen wie H2O, CO2, und O2. Die Bindungen können ein, zwei oder drei Elektronenpaare teilen, wodurch Einzel-, Doppel- bzw. Dreifachbindungen entstehen. Je mehr kovalente Bindungen zwischen zwei Atomen bestehen, desto stärker ist ihre Verbindung. Somit sind Dreifachbindungen die stärksten.

Die Stärke der unterschiedlichen kovalenten Bindungen ist einer der Hauptgründe dafür, dass lebende Organismen Schwierigkeiten haben, Stickstoff für den Aufbau ihrer Moleküle zu gewinnen, obwohl molekularer Stickstoff, N2, ist das am häufigsten vorkommende Gas in der Atmosphäre. Molekularer Stickstoff besteht aus zwei dreifach aneinander gebundenen Stickstoffatomen, und wie bei allen Molekülen ermöglicht die Aufteilung dieser drei Elektronenpaare zwischen den beiden Stickstoffatomen das Auffüllen ihrer äußeren Elektronenhüllen, wodurch das Molekül stabiler wird als die einzelnen Stickstoffatome. Diese starke Dreifachbindung macht es lebenden Systemen schwer, diesen Stickstoff aufzuspalten, um ihn als Bestandteil von Proteinen und DNA zu verwenden.

Die Bildung von Wassermolekülen ist ein Beispiel für kovalente Bindungen. Kovalente Bindungen binden die Wasserstoff- und Sauerstoffatome, die sich zu Wassermolekülen verbinden, wie Abbildung 2.9 zeigt. Das Elektron aus dem Wasserstoff teilt seine Zeit zwischen der unvollständigen äußeren Hülle der Wasserstoffatome und der unvollständigen äußeren Hülle der Sauerstoffatome auf. Um die äußere Hülle des Sauerstoffs, die sechs Elektronen besitzt, aber mit acht stabiler wäre, vollständig zu füllen, werden zwei Elektronen (eines von jedem Wasserstoffatom) benötigt: daher die bekannte Formel H2O. Die beiden Elemente teilen sich die Elektronen, um die äußere Hülle jedes einzelnen zu füllen, wodurch beide Elemente stabiler werden.

Link zum Lernen

Sehen Sie sich dieses kurze Video an, um eine Animation zur ionischen und kovalenten Bindung zu sehen.

Polare kovalente Bindungen

Es gibt zwei Arten von kovalenten Bindungen: polare und unpolare. Abbildung 2.12 zeigt, dass Atome in einer polaren kovalenten Bindung die Elektronen ungleich teilen und mehr von einem Kern angezogen werden als vom anderen. Wegen der ungleichen Elektronenverteilung zwischen den Atomen verschiedener Elemente ist ein leicht positiver (δ+) oder leicht negativ (δ–) Ladung entwickelt. Diese Teilladung ist eine wichtige Eigenschaft des Wassers und macht viele seiner Eigenschaften aus.

Wasser ist ein polares Molekül, wobei die Wasserstoffatome eine positive Teilladung und der Sauerstoff eine negative Teilladung erhalten. Dies geschieht, weil der Kern des Sauerstoffatoms für die Elektronen der Wasserstoffatome attraktiver ist als der Wasserstoffkern für die Elektronen des Sauerstoffs. Somit hat Sauerstoff eine höhere Elektronegativität als Wasserstoff und die geteilten Elektronen verbringen mehr Zeit in der Nähe des Sauerstoffkerns als im Kern der Wasserstoffatome, wodurch die Sauerstoff- und Wasserstoffatome leicht negative bzw. positive Ladungen erhalten.Eine andere Möglichkeit, dies auszudrücken, ist, dass die Wahrscheinlichkeit, ein gemeinsames Elektron in der Nähe eines Sauerstoffkerns zu finden, wahrscheinlicher ist, als es in der Nähe eines Wasserstoffkerns zu finden. In jedem Fall trägt die relative Elektronegativität des Atoms zur Entwicklung von Teilladungen bei, wenn ein Element deutlich elektronegativer ist als das andere, und die Ladungen, die diese polaren Bindungen erzeugen, können dann verwendet werden, um Wasserstoffbrückenbindungen aufgrund der Anziehung entgegengesetzter Teilladungen zu bilden. (Wasserstoffbrücken, die wir weiter unten im Detail besprechen, sind schwache Bindungen zwischen leicht positiv geladenen Wasserstoffatomen zu leicht negativ geladenen Atomen in anderen Molekülen.) Da Makromoleküle oft Atome enthalten, die sich in der Elektronegativität unterscheiden, sind in organischen Molekülen häufig polare Bindungen vorhanden .

Unpolare kovalente Bindungen

Unpolare kovalente Bindungen bilden sich zwischen zwei Atomen desselben Elements oder zwischen verschiedenen Elementen, die sich die Elektronen gleichmäßig teilen. Molekularer Sauerstoff (O2) ist unpolar, weil sich die Elektronen gleichmäßig zwischen den beiden Sauerstoffatomen verteilen.

Abbildung 2.12 zeigt auch ein weiteres Beispiel für eine unpolare kovalente Bindung – Methan (CH4). Kohlenstoff hat in seiner äußersten Schale vier Elektronen und benötigt vier weitere, um ihn zu füllen. Es erhält diese vier aus vier Wasserstoffatomen, wobei jedes Atom eines liefert, wodurch eine stabile äußere Hülle aus acht Elektronen entsteht. Kohlenstoff und Wasserstoff haben nicht die gleiche Elektronegativität, sind aber ähnlich, daher bilden sich unpolare Bindungen. Die Wasserstoffatome benötigen jeweils ein Elektron für ihre äußerste Schale, die gefüllt ist, wenn sie zwei Elektronen enthält. Diese Elemente teilen sich die Elektronen zu gleichen Teilen auf die Kohlenstoff- und Wasserstoffatome auf, wodurch ein unpolares kovalentes Molekül entsteht.

Wasserstoffbrücken und Van-der-Waals-Wechselwirkungen

Ionische und kovalente Bindungen zwischen Elementen erfordern Energie, um aufzubrechen. Ionische Bindungen sind nicht so stark wie kovalent, was ihr Verhalten in biologischen Systemen bestimmt. Jedoch sind nicht alle Bindungen ionische oder kovalente Bindungen. Auch zwischen Molekülen können sich schwächere Bindungen ausbilden. Zwei häufig auftretende schwache Bindungen sind Wasserstoffbrücken und Van-der-Waals-Wechselwirkungen. Ohne diese beiden Arten von Bindungen würde das Leben, wie wir es kennen, nicht existieren. Wasserstoffbrücken stellen viele der entscheidenden, lebenserhaltenden Eigenschaften von Wasser bereit und stabilisieren auch die Strukturen von Proteinen und DNA, dem Baustein der Zellen.

Wenn sich polare kovalente Bindungen mit Wasserstoff bilden, hat der Wasserstoff in dieser Bindung eine leicht positive Ladung, da das Elektron des Wasserstoffs stärker zum anderen Element und vom Wasserstoff weggezogen wird. Da der Wasserstoff leicht positiv ist, wird er von benachbarten negativen Ladungen angezogen. Dabei kommt es zu einer schwachen Wechselwirkung zwischen dem Wasserstoff δ + von einem Molekül und den des Moleküls δ – Ladung auf einem anderen Molekül mit den elektronegativeren Atomen, normalerweise Sauerstoff. Wissenschaftler nennen diese Wechselwirkung eine Wasserstoffbrücke. Diese Art der Bindung ist weit verbreitet und tritt regelmäßig zwischen Wassermolekülen auf. Einzelne Wasserstoffbrückenbindungen sind schwach und leicht zu brechen, sie kommen jedoch in sehr großer Zahl in Wasser und in organischen Polymeren vor und erzeugen in Kombination eine große Kraft. Wasserstoffbrücken sind auch dafür verantwortlich, dass die DNA-Doppelhelix zusammengefügt wird.

Wie Wasserstoffbrücken sind Van-der-Waals-Wechselwirkungen schwache Anziehungen oder Wechselwirkungen zwischen Molekülen. Van-der-Waals-Anziehungen können zwischen zwei oder mehreren Molekülen auftreten und hängen von leichten Schwankungen der Elektronendichten ab, die nicht immer symmetrisch um ein Atom herum sind. Damit diese Anziehungen stattfinden können, müssen die Moleküle sehr nahe beieinander sein. Diese Bindungen tragen – zusammen mit ionischen, kovalenten und Wasserstoffbrücken – zur dreidimensionalen Struktur der Proteine ​​in unseren Zellen bei, die für ihre ordnungsgemäße Funktion notwendig ist.

Karriereverbindung

Pharmazeutischer Chemiker

Pharmazeutische Chemiker sind dafür verantwortlich, neue Medikamente zu entwickeln und die Wirkungsweise alter und neuer Medikamente zu bestimmen. Sie sind an jedem Schritt des Arzneimittelentwicklungsprozesses beteiligt. Wir können Medikamente in der natürlichen Umgebung finden oder im Labor synthetisieren. In vielen Fällen verändern Chemiker potenzielle Medikamente aus der Natur chemisch im Labor, um sie sicherer und wirksamer zu machen, und manchmal ersetzen synthetische Versionen von Medikamenten die Versionen, die wir in der Natur finden.

Nach der ersten Entdeckung oder Synthese eines Medikaments entwickelt der Chemiker das Medikament, verändert es möglicherweise chemisch, testet es auf seine Toxizität und entwickelt dann Methoden für eine effiziente Produktion im großen Maßstab. Dann beginnt der Prozess der Zulassung des Arzneimittels für den menschlichen Gebrauch. In den Vereinigten Staaten kümmert sich die Food and Drug Administration (FDA) um die Arzneimittelzulassung. Dies beinhaltet eine Reihe von groß angelegten Experimenten mit menschlichen Probanden, um sicherzustellen, dass das Medikament nicht schädlich ist und den Zustand, für den es bestimmt ist, wirksam behandelt. Dieser Prozess dauert oft mehrere Jahre und erfordert die Beteiligung von Ärzten und Wissenschaftlern sowie Chemikern, um die Tests abzuschließen und die Zulassung zu erhalten.

Ein Beispiel für ein Medikament, das ursprünglich in einem lebenden Organismus entdeckt wurde, ist Paclitaxel (Taxol), ein Krebsmedikament zur Behandlung von Brustkrebs. Dieses Medikament wurde in der Rinde der pazifischen Eibe entdeckt. Ein weiteres Beispiel ist Aspirin, das ursprünglich aus Weidenrinde isoliert wurde. Medikamente zu finden bedeutet oft, Hunderte von Proben von Pflanzen, Pilzen und anderen Lebensformen zu testen, um zu sehen, ob sie biologisch aktive Verbindungen enthalten. Manchmal kann die traditionelle Medizin der modernen Medizin Hinweise geben, wo ein Wirkstoff zu finden ist. Zum Beispiel verwendet die Menschheit seit Tausenden von Jahren Weidenrinde, um Medizin herzustellen, die bis ins alte Ägypten zurückreicht. Es dauerte jedoch bis Ende des 19. Jahrhunderts, dass Wissenschaftler und Pharmaunternehmen das Aspirin-Molekül Acetylsalicylsäure für den menschlichen Gebrauch aufbereiteten und vermarkteten.

Gelegentlich haben Medikamente, die für einen bestimmten Gebrauch entwickelt wurden, unvorhergesehene Wirkungen, die eine Verwendung auf andere, nicht zusammenhängende Weise ermöglichen. Zum Beispiel haben Wissenschaftler ursprünglich das Medikament Minoxidil (Rogaine) zur Behandlung von Bluthochdruck entwickelt. Bei Tests an Menschen stellten die Forscher fest, dass Personen, die das Medikament einnahmen, neue Haare wachsen ließen. Schließlich vermarktete das Pharmaunternehmen das Medikament an Männer und Frauen mit Kahlheit, um verlorenes Haar wiederherzustellen.

Die Karriere eines pharmazeutischen Chemikers kann Detektivarbeit, Experimente und Medikamentenentwicklung beinhalten, alles mit dem Ziel, die Menschen gesünder zu machen.


IPCC Klimawandel 2001: Die wissenschaftliche Grundlage (Hrsg. Houghton, J.T. et al.) (Cambridge Univ. Press, 2001).

IPCC Klimawandel 2007: Die physikalisch-wissenschaftliche Basis (Hrsg. Solomon, S. et al.) (Cambridge Univ. Press, 2007).

Biro, P. A., Beckmann, C. & Stamps, J. A. Kleine Temperaturerhöhungen innerhalb eines Tages wirken sich auf die Kühnheit aus und verändern die Persönlichkeit von Korallenrifffischen. Proz. R. Soc. B. 277, 71–77 (2010).

Brodie, E. D. & Russell, N. H. Die Konsistenz individueller Verhaltensunterschiede: Temperatureffekte auf das Verhalten von Antiprädatoren bei Strumpfbandnattern. Anim. Verhalten 57, 445–451 (1999).

Parmesan, C. & Yohe, G. Ein global kohärenter Fingerabdruck der Auswirkungen des Klimawandels auf natürliche Systeme. Natur 421, 37–42 (2003). Ein umfassender Überblick über phonologische Veränderungen als Reaktion auf den Klimawandel.

Parolin, P., Lucas, C., Piedade, M. T. F. & Wittmann, F. Dürrereaktionen von überschwemmungstoleranten Bäumen in Amazonas-Überschwemmungsgebieten. Ann. Bot. 105, 129–139 (2010).

Bizer, J. R. Wachstumsraten und Größe bei der Metamorphose hochgelegener Populationen von Ambystoma tigrinum. Ökologie 34, 175–184 (1978).

Irie, T. & Fischer, K. Ektothermen mit einem kalkhaltigen Exoskelett folgen dem Temperatur-Größen-Regel-Beweis aus der Felduntersuchung. März Ökol. Prog. Ser. 385, 33–37 (2009).

Bickford, D., Sheridan, J. A. & Howard, S. D. Antworten auf den Klimawandel: Frösche, Farne und Fliegen vergessen? Trends Öko. Entwicklung http://dx.doi.org/10.1016/j.tree.2011.06.016 (2011).

Daaufresne, M., Lengfellner, K. & Sommer, U. Die globale Erwärmung kommt den Kleinen in aquatischen Ökosystemen zugute. Proz. Natl Acad. Wissenschaft Vereinigte Staaten von Amerika 106, 12788–12793 (2009). Eine der ersten Veröffentlichungen, die einen Zusammenhang zwischen Klimaerwärmung und reduzierter Körpergröße vorschlägt.

Gardner, J. L., Peters, A., Kearney, M. R., Joseph, L. & Heinsohn, R. Abnehmende Körpergröße: eine dritte universelle Reaktion auf Erwärmung? Trends Öko. Entwicklung 26, 285–291 (2011). Ein Überblick über die Trends bei der Größenreduzierung im Zusammenhang mit dem Klimawandel, wobei der Schwerpunkt auf Vögeln und anderen Endothermen liegt.

Smith, J. J., Hasiotis, S. T., Kraus, M. J. & Woody, D. T. Transienter Zwergwuchs der Bodenfauna während des Paläozän-Eozän-Thermalmaximums. Proz. Natl Acad. Wissenschaft Vereinigte Staaten von Amerika 106, 17655–17660 (2009).

Hadly, E. A., Kohn, M. H., Leonard, J. A. & Wayne, R. K. Eine genetische Aufzeichnung der Populationsisolation bei Taschengophern während des holozänen Klimawandels. Proz. Natl Acad. Wissenschaft Vereinigte Staaten von Amerika 95, 6893–6896 (1998).

Blois, J. L., Feranec, R. S. & Hadly, E. A. Umwelteinflüsse auf räumliche und zeitliche Muster der Körpergrößenvariation bei kalifornischen Erdhörnchen (Spermophilus beecheyi). J. Biogeogr. 35, 602–613 (2008).

Finkel, Z. V., Katz, M. E., Wright, J. D., Schofield, O. M. E. & Falkowski, P. G. Klimatisch bedingte makroevolutionäre Muster in der Größe mariner Kieselalgen im Känozoikum. Proz. Natl Acad. Wissenschaft Vereinigte Staaten von Amerika 102, 8927–8932 (2005).

Smith, F. A., Betancourt, J. L. & Brown, J. H. Evolution der Körpergröße der Waldratte in den letzten 25.000 Jahren des Klimawandels. Wissenschaft 270, 2012–2014 (1995).

Jokiel, P.L.et al. Ozeanversauerung und verkalkende Rifforganismen: eine Mesokosmos-Untersuchung. Korallenriffe 27, 473–483 (2008).

Ries, J. B., Cohen, A. L. & McCorkle, D. C. Marine Calcifiers zeigen gemischte Reaktionen auf CO2-induzierte Ozeanversauerung. Geologie 37, 1131–1134 (2009).

Gooding, R. A., Harley, C. D. G. & Tang, E. Erhöhte Wassertemperatur und Kohlendioxidkonzentration erhöhen das Wachstum eines Keystone-Stachelhäuters. Proz. Natl Acad. Wissenschaft Vereinigte Staaten von Amerika 106, 9316–9321 (2009).

Shi, D., Xu, Y., Hopkinson, B. M. & Morel, F. M. M. Auswirkung der Ozeanversauerung auf die Eisenverfügbarkeit für marines Phytoplankton. Wissenschaft 327, 676–679 (2010).

Hovenden, M.J. et al. Erwärmung und erhöhtes CO2 beeinflussen das Verhältnis zwischen Samenmasse, Keimfähigkeit und Keimlingswachstum in Austrodanthonia caespitosa, ein dominantes australisches Gras. Globus. Biol. ändern 14, 1633–1641 (2008).

Kim, S.H.et al. Temperaturabhängigkeit von Wachstum, Entwicklung und Photosynthese bei Mais unter erhöhtem CO2 . Umgebung. Erw. Bot. 61, 224–236 (2007).

Ledesma, N. A., Nakata, M. &. Sugiyama, N. Auswirkung von Stress bei hoher Temperatur auf das reproduktive Wachstum von Erdbeer-Cvs. 'Nyoho' und 'Toyonoka'. Wissenschaft Hortic. 116, 186–193 (2008).

Utsunomiya, N. Einfluss der Temperatur auf das Sprosswachstum, die Blüte und das Fruchtwachstum der lila Passionsfrucht (Passiflora edulis Sims var. edulis). Wissenschaft Hortic. 52, 63–68 (1992).

Williamson, C. E., Grad, G., De Lange, H. J., Gilroy, S. & Karapelou, D. M. Temperaturabhängige ultraviolette Reaktionen in Zooplankton: Auswirkungen des Klimawandels. Limnol. Ozeanogr. 47, 1844–1848 (2002).

Desai, A. S. & Singh, R. K. Die Auswirkungen von Wassertemperatur und Rationsgröße auf Wachstum und Körperzusammensetzung von Jungkarpfen, Cyprinus carpio. J. Therm. Biol. 34, 276–280 (2009).

Sahin, T. Einfluss der Wassertemperatur auf das Wachstum von Schwarzmeer-Steinbutt in Brutanlagen, Scophthalmus maximus (Linn, 1758). Türke. J. Zool. 25, 183–186 (2001).

Stillwell, R. C. & Fox, C. W. Geographische Variation der Körpergröße, des sexuellen Größendimorphismus und der Fitnesskomponenten eines Saatkäfers: lokale Anpassung versus phänotypische Plastizität. Oikos 118, 703–712 (2009).

Vincent, G., de Foresta, H. & Mulia, R. Gemeinsam vorkommende Baumarten zeigen eine gegensätzliche Empfindlichkeit gegenüber ENSO-bedingten Dürren in gepflanzten Dipterocarp-Wäldern. Waldök. Verwalten. 258, 1316–1322 (2009).

Brady, L. D. & Griffiths, R. A. Entwicklungsreaktionen auf Teichaustrocknung bei Kaulquappen der britischen Anura-Amphibien (Bufo bufo, B. Calamitas und Rana temporaria). J. Zool. 252, 61–69 (2000).

Crump, M. L. Auswirkung der Habitattrocknung auf die Entwicklungszeit und -größe bei der Metamorphose in Hyla pseudopuma. Copeia 1989, 794–797 (1989).

Denver, R. J., Mirhadi, N. &. Phillips, M. Adaptive Plastizität bei der Amphibienmetamorphose: Reaktion von Scaphiopus hammondii Kaulquappen zur Austrocknung des Lebensraums. Ökologie 79, 1859–1872 (1998).

Yom-Tov, Y. &. Geffen, E. Geografische Variation der Körpergröße: die Auswirkungen von Umgebungstemperatur und Niederschlag. Ökologie 148, 213–218 (2006).

Jacoby, G.C. & Darrigo, R.D. Baumringbreite und -dichte: Beweise für klimatische und potenzielle Waldveränderungen in Alaska. Globus. Biogeochem. Fahrräder 9, 227–234 (1995).

Reich, P.B. et al. Stickstofflimitierung schränkt die Nachhaltigkeit der Reaktion des Ökosystems auf CO2 ein. Natur 440, 922–925 (2006).

Barber, V. A., Juday, G. P. & Finney, B. P. Reduziertes Wachstum der Alaska-Weißfichte im 20. Jahrhundert durch temperaturbedingten Trockenstress. Natur 405, 668–673 (2000).

Franks, S. J. & Weis, A. E. Eine Klimaänderung verursacht eine schnelle Entwicklung mehrerer Merkmale der Lebensgeschichte und ihrer Interaktionen in einer einjährigen Pflanze. J. Evol. Biol. 21, 1321–1334 (2008).

Reading, C. J. Verknüpfung der globalen Erwärmung mit dem Rückgang der Amphibien durch ihre Auswirkungen auf den weiblichen Körperzustand und die Überlebenschancen. Ökologie 151, 125–131 (2007).

Loehr, V. J. T., Hofmeyr, M. D. & Henen, B. T. Wachsen und Schrumpfen in der kleinsten Schildkröte, Homopus signatus signatus: die Bedeutung des Regens. Ökologie 153, 479–488 (2007).

Wikelski, M. & Thom, C. Meeresleguane schrumpfen, um El Niño zu überleben. Natur 403, 37–38 (2000).

Gardner, J. L., Heinsohn, R. & Joseph, L. Die Verschiebung der Breitengrade bei der Körpergröße von Vögeln korreliert mit der globalen Erwärmung bei australischen Sperlingsvögeln. Proz. R. Soc. B 276, 3845–3852 (2009).

Yom-Tov, Y., Yom-Tov, S., Wright, J., Thorne, C.J.R. & Du Feu, R. Jüngste Veränderungen des Körpergewichts und der Flügellänge bei einigen britischen Singvögeln. Oikos 112, 91–101 (2006).

Teplitsky, C., Mills, J. A., Alho, J. S., Yarrall, J. W. & Merila, J. Bergmann's Rule and Climate Change revisited: Disentangling Environmental and Genetic responses in a Wild Bird Population. Proz. Natl Acad. Wissenschaft Vereinigte Staaten von Amerika 105, 13492–13496 (2008).

Yom-Tov, Y. Globale Erwärmung und Abnahme der Körpermasse bei israelischen Singvögeln. Proz. R. Soc. Lange. B 268, 947–952 (2001).

Smith, F. A., Browning, H. & Shepherd, U. L. Der Einfluss des Klimawandels auf die Körpermasse von Waldratten Neotoma in einer trockenen Region von New Mexico, USA. Ökographie 21, 140–148 (1998).

Ozgul, A. et al. Die Dynamik des phänotypischen Wandels und die schrumpfenden Schafe von St. Kilda. Wissenschaft 325, 464 (2009).

Post, E., Stenseth, N.C., Langvatn, R. & Fromentin, J.M. Globaler Klimawandel und phänotypische Variation unter Rotwild-Kohorten. Proz. R. Soc. Lange. B. 264, 1317–1324 (1997). Eines der ersten Beispiele für reduzierte Körpergröße im Zusammenhang mit der Klimaerwärmung.

Regehr, E.V., Amstrup, S.C. & Stirling, I. Populationsstatus der Eisbären in der südlichen Beaufortsee Open-File-Bericht 2006–1337 (US Geological Survey, 2006).

Rode, K. D., Amstrup, S. C. & Regehr, E. V. Reduzierte Körpergröße und Nachwuchsrekrutierung bei Eisbären im Zusammenhang mit dem Rückgang des Meereises. Öko. Appl. 20, 768–782 (2010).

Vitousek, P. M., Gosz, J. R., Grier, C. C., Melillo, J. M. & Reiners, W. A. ​​Eine vergleichende Analyse der potentiellen Nitrifikation und Nitratmobilität in Waldökosystemen. Öko. Monogr. 52, 155–177 (1982).

Ojima, D.S. Die kurz- und langfristigen Auswirkungen des Verbrennens auf die Eigenschaften und die Dynamik des Tallgrass-Prärie-Ökosystems Doktorarbeit, Colorado State Univ. (1987).

Reiners, W. S. Stickstoffkreislauf in Bezug auf die Ökosystemnachfolge: eine Übersicht. Öko. Stier. 33, 507–528 (1981).

Austin, A. T. & Vitousek, P. M. Nährstoffdynamik auf einem Niederschlagsgradienten in Hawaii. Ökologie 113, 519–529 (1998).

Gillooly, J. F., Brown, J. H., West, G. B., Savage, V. M. & Charnov, E. L. Auswirkungen von Größe und Temperatur auf die Stoffwechselrate. Wissenschaft 293, 2248–2251 (2001). Eine umfassende Darstellung des Zusammenhangs zwischen Temperatur und Stoffwechsel, der für die Größenreduktion von Ektothermen von zentraler Bedeutung ist.

Bickford, D., Howard, S. D., Ng, D. J. J. & Sheridan, J. A. Auswirkungen des Klimawandels auf die Amphibien und Reptilien Südostasiens. Biodivers. Konserv. 19, 1043–1062 (2010).

Atkinson, D. in Fortschritte in der ökologischen Forschung vol. 25 (Hrsg. Begon, M. &. Fitter, A. H.) 1–58 (Academic Press, 1994).

van der Have, T. M. & de Jong, G. Erwachsene Größe in Ektothermen: Temperatureffekte auf Wachstum und Differenzierung. J. Theor. Biol. 183, 329–340 (1996).

Li, W. K. W., McLaughlin, F. A., Lovejoy, C. & Carmack, E. C. Die kleinsten Algen gedeihen, wenn sich der Arktische Ozean erfrischt. Wissenschaft 326, 539 (2009).

Peck, L. S., Clark, M. S., Morley, S. A., Massey, A. & Rossetti, H. Tiertemperaturgrenzen und ökologische Relevanz: Auswirkungen von Größe, Aktivität und Änderungsraten. Funktion Öko. 23, 248–256 (2009).

Wikelski, M. & Thom, C. Meeresleguane schrumpfen, um El Niño zu überleben. Natur 403, 37–38 (2000).

Blauweiss, L. et al. Beziehungen zwischen Körpergröße und einigen Parametern der Lebensgeschichte. Ökologie 37, 257–272 (1978).

Watt, C., Mitchell, S. &. Salewski, V. Bergmanns Regel ein Konzeptcluster? Oikos 119, 89–100 (2010).

Blackburn, T. M. & Hawkins, B. A. Bergmanns Regel und die Säugetierfauna des nördlichen Nordamerikas. Ökographie 27, 715–724 (2004).

Diniz-Filho, J. A., Bini, L. M., Rodriguez, M. A., Rangel, T. & Hawkins, B. A. Den Wald vor lauter Bäumen sehen: Aufteilung der ökologischen und phylogenetischen Komponenten von Bergmanns Herrschaft im europäischen Carnivora. Ökographie 30, 598–608 (2007).

Ramirez, L., Diniz, J. A. F. & Hawkins, B. A. Aufteilung der phylogenetischen und adaptiven Komponenten des geografischen Körpergrößenmusters von Vögeln der neuen Welt. Globus. Öko. Biogeogr. 17, 100–110 (2008).

Heatwole, H., Torres, F., Deaustin, S.B. & Eleutherodactylus portoricensis. Komp. Biochem. Physiol. 28, 245–269 (1969).

Gill, R.A., Anderson, L.J., Polley, H.W., Johnson, H.B. & Jackson, R.B. Ökologie 87, 41–52 (2006).

Phillips, O.L. et al. Zunehmende Dominanz großer Lianen in Amazonaswäldern. Natur 418, 770–774 (2002).

ter Hofstede, R. & Rijnsdorp, A. D. Vergleich von Grundfischansammlungen zwischen Perioden mit kontrastierendem Klima und Fischereidruck. ICES J. Mar. Sci. 68, 1189–1198 (2011).

Ernährungs-und Landwirtschaftsorganisation Wie man die Welt im Jahr 2050 ernährt (Vereinte Nationen, 2009) verfügbar über http://go.nature.com/WFBRBm.

Thresher, R.E., Koslow, J.A., Morison, A.K. & Smith, D.C. Tiefenvermittelte Umkehr der Auswirkungen des Klimawandels auf die langfristigen Wachstumsraten von ausgebeuteten Meeresfischen. Proz. Natl Acad. Wissenschaft Vereinigte Staaten von Amerika 104, 7461–7465 (2007).

Todd, C. D. et al. Schädliche Auswirkungen der jüngsten Erwärmung der Meeresoberfläche auf die Wachstumsbedingungen des Atlantischen Lachses. Globus. Biol. ändern 14, 958–970 (2008).

Chamaille-Jammes, S., Massot, M., Aragon, P. & Clobert, J. Globale Erwärmung und positive Fitnessreaktion in Bergpopulationen von Eidechsen Lacerta vivipara. Globus. Biol. ändern 12, 392–402 (2006).

Guillemain, M. et al. Überwinternde Stockente und Krickente sind schwerer und in besserer körperlicher Verfassung als vor 30 Jahren: Auswirkungen einer sich verändernden Umwelt? Ambio 39, 170–180 (2010).

Yom-Tov, Y. & Yom-Tov, S. Abnahme der Körpergröße dänischer Habichte im 20. Jahrhundert. J. Ornithol. 147, 644–647 (2006).

Salewski, V., Hochachka, W. M. & Fiedler, W. Globale Erwärmung und Bergmannsche Regel: Passen mitteleuropäische Singvögel ihre Körpergröße an steigende Temperaturen an? Ökologie 162, 247–260 (2010).

Moreno-Rueda, G. &. Rivas, J. M.Jüngste Änderungen der allometrischen Beziehungen zwischen morphologischen Merkmalen in der Wasseramsel (Cinclus Cinclus). J. Ornithol. 148, 489–494 (2007).

Kanuscak, P., Hromada, M., Tryjanowski, P. & Sparks, T. Beeinflusst das Klima auf verschiedenen Skalen die Phänologie und den Phänotyp der Flusssänger? Locustella fluviatilis? Ökologie 141, 158–163 (2004).

Proffitt, K. M., Garrott, R. A., Rotella, J. J., Siniff, D. B. & Testa, J. W. Erforschung von Verbindungen zwischen abiotischen ozeanographischen Prozessen und einem toptrophischen Raubtier in einem antarktischen Ökosystem. Ökosysteme 10, 119–126 (2007).

Yom-Tov, Y., Yom-Tov, S. &. Jarrell, G. Kürzliche Zunahme der Körpergröße des amerikanischen Marders Martes Americana in Alaska. Biol. J. Linn. Soz. 93, 701–707 (2008).

Yom-Tov, Y. & Yom-Tov, J. Globale Erwärmung, Bergmanns Regel und Körpergröße bei der maskierten Spitzmaus Sorex cinereus Kerr in Alaska. J. Anim. Öko. 74, 803–808 (2005).

Yom-Tov, Y. & Yom-Tov, S. Klimatische Veränderungen und Körpergröße in zwei Arten japanischer Nagetiere. Biol. J. Linn. Soz. 82, 263–267 (2004).

Meiri, S., Guy, D., Dayan, T. & Simberloff, D. Globaler Wandel und Körpergröße von Fleischfressern: Daten sind Stasis. Globus. Öko. Biogeogr. 18, 240–247 (2009).

Luque, S. P. &. Ferguson, S. H. Veränderungen des Ökosystem-Regimes haben das Wachstum und das Überleben der Belugas in der östlichen Beaufortsee nicht beeinflusst. Ökologie 160, 367–378 (2009).

Yom-Tov, Y., Heggberget, T.M., Wiig, O.& Yom-Tov, S. Körpergröße ändert sich unter Ottern, Lutra lutra, in Norwegen: die möglichen Auswirkungen der Nahrungsmittelverfügbarkeit und der globalen Erwärmung. Ökologie 150, 155–160 (2006).

Koontz, T. L., Shepherd, U. L. & Marshall, D. Die Auswirkungen des Klimawandels auf Merriams Känguru-Ratte, Dipodomys merriami. J. Trockene Umgebung. 49, 581–591 (2001).

Yom-Tov, Y. et al. Jüngste Veränderungen der Körpergröße des Eurasischen Fischotters Lutra lutra in Schweden. Ambio 39, 496–503 (2010).

Stillwell, R. C. Sind Breitengrade in der Körpergröße adaptiv? Oikos 119, 1387–1390 (2010).

Arft, A.M.et al. Reaktionen von Tundrapflanzen auf experimentelle Erwärmung: Meta-Analyse des internationalen Tundra-Experiments. Öko. Monogr. 69, 491–511 (1999).

Yom-Tov, Y. Die Körpergröße von Fleischfressern, die mit dem Menschen kommen, hat in den letzten 50 Jahren zugenommen. Funktion Öko. 17, 323–327 (2003).

Urban, M.C., Phillips, B.L., Skelly, D.K.&Amp Shine, R. Die Zuckerrohrkröte (Chaunus [Bufo] marinus) die zunehmende Fähigkeit, in Australien einzudringen, wird durch ein dynamisch aktualisiertes Reichweitenmodell aufgedeckt. Proz. R. Soc. B. 274, 1413–1419 (2007).


4. Diskussion

Im letzten Jahrhundert wurde eine ständige Entwicklung neuer pharmakologischer Strategien zur Krebsbehandlung beobachtet. Trotz der Wirksamkeit dieser neuen Therapien sinken die Mortalitätsraten bei aggressiven Tumoren jedoch noch nicht signifikant, da erhöhte Inzidenzraten mit einem Anstieg der Resistenzmechanismen einhergehen [209]. Aufgrund des Fehlens einer gezielten medikamentösen Therapie und der Unwirksamkeit chirurgischer Eingriffe zur Behandlung des Glioblastoms kommt der Entwicklung von Methoden zur Früherkennung dieser Erkrankung eine besondere Bedeutung zu. Bestehende klinische Ansätze zum Nachweis von Glioblastomen sind oft ineffektiv und hängen stark von Ergebnissen ab, die mit bildgebenden Verfahren wie der MRT erzielt werden. Die Entwicklung von Hirntumoren, insbesondere in den frühen Stadien, kann jedoch keine klaren und frühen klinischen Symptome aufweisen. Darüber hinaus ist der Einsatz von Neuroimaging-Methoden für das Massenscreening kaum geeignet, und eine solche Bewertung ermöglicht nicht immer eine effektive Bestimmung des Vorliegens und der Bösartigkeit eines Hirntumors [18,19].

Die Auswahl vielversprechender Biomarker ist auch mit der Wahl einer robusten Analysemethode für deren Analyse verbunden. Die auf die Analyse biologischer Materialien angewendete Massenspektrometrie bietet mehrere Vorteile, darunter empfindliche Detektion, hohe Leistung, Selektivität und die Möglichkeit, eine breite Palette chemischer Verbindungen zu analysieren. Insbesondere für die Analyse von biologischen Proben mit intrinsischer Variabilität wie Tumorgewebe ist die Hochleistungs-Massenspektrometrie wichtig. Massenspektrometrische Verfahren können langfristig eine erhebliche Anzahl von labordiagnostischen Verfahren ersetzen. Im Vergleich zu Methoden, die auf der Verwendung von Antikörpern basieren, haben sich massenspektrometrische Nachweismethoden als die besten Indikatoren mit verbesserter Nachweisgrenze, Reproduzierbarkeit, Genauigkeit und Präzision erwiesen [210].

Um eine frühzeitige Diagnose des Glioblastoms zu ermöglichen, sind die vielversprechendsten Biomarker aus Tumoren gewonnene Proteine ​​und Nukleinsäuren. Die Analyse von Nukleinsäuren ist heute in die klinische Praxis eingeführt und wird derzeit zur Diagnose und Prognose der Krankheit verwendet. Die Nukleinsäureanalyse allein reicht jedoch nicht aus, um die Art des Tumors effektiv zu bestimmen. Auf dieser Grundlage sind weitere Studien mit anderen analytischen Ansätzen und anderen Arten von Proben erforderlich, um die Diagnose von Patienten zu verbessern.

In diesem Zusammenhang bietet die proteomische Analyse mit massenspektrometrischen Methoden vielversprechende Ergebnisse, die den Nachweis sowohl tumorspezifischer Proteine ​​als auch posttranslationaler Modifikationen ermöglichen. Die qualitative oder quantitative Bewertung des Proteinexpressionsmusters oder der posttranslationalen Modifikationsänderungen des Proteins kann als Marker für bösartige ZNS-Tumoren dienen [108,211]. Die proteomische Analyse mittels Massenspektrometrie ermöglicht es dem Forscher, nicht nur die vollständigen proteomischen Profile von gesunden und pathologischen Proben zu vergleichen, sondern auch das Vorhandensein einer Reihe von Proteinveränderungen mit dem Vorhandensein eines bestimmten Krankheitszustands zu korrelieren [151]. Dieser Aspekt ist äußerst wichtig für die Einführung der Massenspektrometrie in die klinische Routinediagnostik von ZNS-onkologischen Erkrankungen. Es ist auch anzumerken, dass die technischen Eigenschaften moderner Massenanalysatoren die Analyse mehrerer individueller molekularer Muster, die für mehrere Pathologien charakteristisch sind, während eines Analysezyklus ermöglichen und damit Perspektiven für die Einführung dieser Analysemethode in die Routinepraxis bieten. Die Verwendung der Multiparameteranalyse wird die Erstellung einer Datenbank mit tumorspezifischen Markern für die klinische Diagnose durch Massenspektrometrie unterstützen. Die experimentelle Modellierung diffuser Gliome ist eine schwierige Aufgabe, da bekannte präklinische Modelle, einschließlich In-vitro-Zelllinien und Xenotransplantate, einige Aspekte der Gliombiologie nicht zuverlässig reproduzieren [212]. Experimentelle Zellmodelle und Xenotransplantate sind jedoch äußerst nützlich, um biologische Proben mit Massenspektrometriemethoden zu testen und zu validieren.

Bei intrakraniellen Tumoren, die für eine häufige Gewebebiopsie nicht zur Verfügung stehen, sind biologische Flüssigkeiten die bevorzugte Quelle zur Überwachung der Tumorbiomarkerspiegel. Die Flüssigbiopsie hat gegenüber der Gewebebiopsie eine Reihe bedeutender Vorteile und ist die vielversprechendste klinische Screening-Methode mit hohem Durchsatz. Die Differentialdiagnose von Gliomen zeigt eine hohe Genauigkeit und Spezifität basierend auf den Proteomic-Profiling-Studien bei Liquor. Die mit der lumbalen Liquorprobenentnahme verbundenen Risiken könnten jedoch die routinemäßige Einführung dieser Methode in die klinische Praxis verhindern. Im Gegensatz dazu stellen patientenbezogene blut- und urinbasierte Flüssigbiopsien vielversprechende nicht-invasive Methoden für Glioblastom, Früherkennung und Staging dar, die aufgrund ihres Hochdurchsatz- und High-Compliance-Potenzials weiterentwickelt werden müssen.


Ist mein Verständnis der Bergmannschen Regel richtig? (Masse ist sekundär) - Biologie

Masse ist ein Maß dafür, wie viel Materie sich in einem Objekt befindet. Masse ist eine Kombination aus der Gesamtzahl der Atome, der Dichte der Atome und der Art der Atome in einem Objekt.

Masse wird normalerweise in Kilogramm gemessen, die als kg abgekürzt wird.

  • Trägheitsmasse - Die Trägheitsmasse wird dadurch bestimmt, wie stark das Objekt der Beschleunigung widersteht. Wenn Sie beispielsweise zwei Objekte unter den gleichen Bedingungen mit der gleichen Kraft schieben, beschleunigt das Objekt mit der geringeren Masse schneller.
  • Gravitationsmasse - Die Gravitationsmasse ist ein Maß dafür, wie viel Gravitation ein Objekt auf andere Objekte ausübt. Es kann auch das Maß dafür sein, wie viel Schwerkraft ein Objekt von einem anderen Objekt erfährt.

Was ist der Unterschied zwischen Masse und Gewicht?

Gewicht unterscheidet sich von Masse. Das Gewicht ist das Maß für die Schwerkraft auf einen Gegenstand. Die Masse eines Objekts ändert sich nie, aber das Gewicht eines Artikels kann sich je nach Position ändern. Auf der Erde könnten Sie beispielsweise 100 Pfund wiegen, aber im Weltraum wären Sie schwerelos. Sie werden jedoch immer die gleiche Masse auf der Erde haben wie im Weltraum.

In den Vereinigten Staaten messen wir Gewicht normalerweise in Pfund, aber in der Physik, wenn wir Gewicht als Kraft beschreiben, wird es im Allgemeinen in Newton gemessen, was als "N" abgekürzt wird.

Masse in Gewicht umrechnen

Da die Schwerkraft auf der Erde ziemlich konstant ist, wird auch das Gewicht konstant sein. Dies ermöglicht es uns, eine Formel zu verwenden, um Gewicht in Masse oder Masse in Gewicht umzuwandeln. Die Formel lautet:

In dieser Gleichung ist die Kraft gleich dem Gewicht. Die Beschleunigung ist die durch die Erdanziehung verursachte Beschleunigung "g", die 9,8 m/s 2 beträgt.

Jetzt können wir Gewicht durch Masse und 9,8 m/s 2 für Beschleunigung ersetzen, um die Formel zu erhalten:

Wie schwer ist ein 50 kg schweres Objekt?

Gewicht = 50 kg * 9,8 m/s 2
Gewicht = 490 N

Ist Masse gleich Größe?

Nein, Masse unterscheidet sich von Größe oder Volumen. Denn die Art der Atome oder Moleküle sowie deren Dichte helfen bei der Bestimmung der Masse. Zum Beispiel hat ein mit Helium gefüllter Ballon viel weniger Masse als ein ähnlich großer Gegenstand aus massivem Gold.

Das Gesetz der Erhaltung der Masse

Die Gesetz der Erhaltung der Masse besagt, dass die Masse eines geschlossenen Systems über die Zeit konstant bleiben muss. Das bedeutet, dass zwar Änderungen an den Objekten eines Systems vorgenommen werden, die Gesamtmasse des Systems jedoch gleich bleiben muss.

  • Das Wort „Masse“ kommt vom griechischen Wort „maza“ und bedeutet „Teigklumpen“.
  • Wissenschaftler schätzen, dass die Gesamtmasse des Universums zwischen 10 52 kg und 10 53 kg liegt.
  • 1000kg entsprechen einer metrischen Tonne. Platon sagte, dass das Gewicht die natürliche Tendenz von Gegenständen sei, ihre Verwandtschaft zu suchen.
  • Die Schwerkraft der Erde kann bis zu 0,5% variieren, je nachdem, wo Sie sich auf der Erde befinden.
  • Wenn Sie auf der Erde 100 Pfund wiegen, würden Sie auf dem Mars 37,7 Pfund und auf dem Jupiter 236,4 Pfund wiegen.

Nehmen Sie an einem Quiz mit zehn Fragen zu dieser Seite teil.
Testen Sie Ihr Wissen mit einem Kreuzworträtsel zum Thema Bewegung.


Schritt 1: Schritt 1: Identifizieren Sie das molekulare Ion

Das Molekülion repräsentiert das gesamte fragliche Molekül vor jeglicher Fragmentierung. Jedes Analytmolekül erhält eine Ladung von eins, sodass der m/z-Wert des Molekülions die Gesamtmasse des Moleküls darstellt. Ionisation, insbesondere Elektronenstoß-(EI)-Ionisation, wird verwendet, um ein Elektron aus einem Analytmolekül zu entfernen, damit es durch die elektrischen und magnetischen Felder des Massenspektrometers analysiert werden kann. EI ist jedoch eine „harte“ Ionisationsquelle, die dazu führen kann, dass Moleküle fragmentieren oder in mehrere Teile zerbrechen. Daher ist es wichtig, zuerst das molekulare (vollständige) Ion zu identifizieren.

1. Das Molekülion wird im Massenspektrum typischerweise als Peak mit dem höchsten m/z-Verhältnis dargestellt. Suchen und notieren Sie diesen Wert in Ihrem Notizbuch.

Beispiel: Im EI-Massenspektrum von Wasser (siehe oben) ist ein großer Peak bei m/z-Wert 18 zu sehen. Wasser hat ein Gewicht von 18 atomaren Masseneinheiten oder Dalton, also repräsentiert der Peak bei m/z 18 das Molekülion . Der kleinere Peak bei m/z 17 stellt ein Wassermolekül dar, in dem ein Wasserstoff durch Fragmentierung entfernt wird.


Das kompakte Hartgewebe, das die äußere Hülle eines Knochens bildet und die Markhöhle umgibt.

Die geschichtete Fasermembran, die die Oberfläche des Knochengewebes bedeckt. Es enthält Osteoblasten-Vorläufer.

Knochen, die die Mittelachse des Körpers bilden, einschließlich der Knochen des Schädels, der Wirbel, der Rippen und des Brustbeins.

Die Knochen der Gliedmaßen, der Schultern und des Hüftgürtels.

Mesodermale Strukturen, die in Wirbeltierembryonen auf beiden Seiten des Neuralrohrs gefunden werden und schließlich zu Muskeln, Haut und Wirbeln führen.

Das Schlüsselbein, das Schulterblatt und Brustbein verbindet.

Ein Organ oder Gewebe in seinen frühesten Entwicklungsstadien, auch als Anlage bekannt.

Membranbedeckte Räume (weiche Stellen) zwischen benachbarten Knochen im Schädel eines Neugeborenen.

Eine beim Menschen autosomal-dominant vererbte Erkrankung mit anhaltend offenen Schädelnähten und vorgewölbter Schädeldecke, Hypoplasie oder Aplasie der Schlüsselbeine. Die Störung wird durch Funktionsverlustmutationen in verursacht RUNX2.

Die geschichtete Fasermembran, die die Knorpeloberfläche bedeckt. Zellen, die sich innerhalb des Perichondriums befinden, einschließlich Osteoblasten-Vorläuferzellen, werden als perichondriale Zellen bezeichnet.

Im Vergleich zu kortikalem Knochen das poröse und weniger dichte Knochengewebe an den Enden der Röhrenknochen und im Inneren der Wirbel.

Eine seltene autosomal-dominant vererbte Erkrankung, die durch kraniofaziale Anomalien und generalisierte Osteoporose gekennzeichnet ist. Verursacht durch abschneidende Mutationen in Exon 34 von NOTCH2.

Ein Zustand, bei dem die Knochenmineraldichte niedriger als normal, aber nicht niedrig genug ist, um als Osteoporose angesehen zu werden.

Eine autosomal-rezessive Erkrankung beim Menschen, die durch schwere juvenil beginnende Osteoporose und angeborene oder juvenil beginnende Blindheit gekennzeichnet ist. Verursacht durch Funktionsverlust-Mutationen im Low-Density-Lipoprotein-Rezeptor-verwandten Protein 5 (LRP5).

Eine seltene autosomal-rezessive Erkrankung, die durch eine generalisierte Knochenverdickung (meist ausgeprägt im Schädel und Unterkiefer), hohe Statur und Handfehlbildungen gekennzeichnet ist. Verursacht durch Funktionsverlust-Mutationen in SOST.

Eine seltene autosomal-rezessive Erkrankung, die durch eine generalisierte Knochenverdickung gekennzeichnet ist, ähnlich der Sklerosteose, jedoch ohne große Statur oder Handfehlbildungen. Verursacht durch eine Löschung nach SOST.



Bemerkungen:

  1. Gradon

    SUPER!!!! Seriously very cool.

  2. Parle

    Sie haben einen Fehler gemacht, es ist offensichtlich.

  3. Branhard

    Ich glaube, es gibt immer eine Möglichkeit.

  4. Taulmaran

    Welche notwendigen Wörter ... Super, eine großartige Phrase

  5. Dar-El-Salam

    Ich bitte um Verzeihung, dass ich einzugreifen, aber Sie konnten nicht ein wenig mehr Informationen geben.



Eine Nachricht schreiben