Information

Ausgabe von clustalo auf (1.2.1) unter Ubuntu 14.04

Ausgabe von clustalo auf (1.2.1) unter Ubuntu 14.04



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Ich versuche, die folgenden 8 Sequenzen mit clustalo auf dem Ubuntu-Terminal mit dem folgenden Befehl auszurichten. Aber ich bekomme nicht die richtige Ausgabe.

clustalo -i sequence.fasta -o output.clu

Meine Eingabedatei istsequenz.fastamit 8 Sequenzen, die ich von BLAST heruntergeladen habe

Meine Ausgabedateiausgabe.clu

Die Ausgabe, auf die ich gehofft hatte AusgabeOnline.clustal

Außerdem würde ich mich freuen, wenn mir jemand sagen könnte, wie ich diese Art von Daten in einer Frage weitergeben kann, da meine Vorgehensweise offensichtlich nicht angemessen erscheint.


Sie müssen nur das Ausgabeformat mit dem angebenoutfmtFlagge.

clustalo -i sequence.fasta -o output.clu -outfmt=clu

sollte dir die gewünschte Ausgabe bringen.


Wie teile ich Daten?

Versuchen Sie es mit einem abgekürzten Beispiel, das die Leute kopieren und einfügen können. Für längere Daten könnten Sie etwas wie http://pastebin.com/ verwenden, aber die URL kann ablaufen.

gi|1709777|sp|P51780.1|PRIO_TRIVU MGKIQLGYWILVLFIVTWSDLGLCKKPKPRPGGGWNSGGSNRYPGQPGSPGGNRYPGWGHPQGGGTNWGQPHPGGSNWGQPHPGGSSWGQPHGGSNWGQGGYNKWKPDKPKT

gi|1709773|sp|P52114.1|PRIO_MUSPF MVKSHIGSWLLVLFVATWSDIGFCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGGSHGQWGKPSKPKT

gi|1709774|sp|P49927.1|PRIO_PIG MVKSHIGGWILVLFVAAWSDIGLCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGGSHGQWNKPSKPKT


&ldquoEingabe-/Ausgabefehler&rdquo beim Zugriff auf ein Verzeichnis

Ich möchte den Inhalt eines Verzeichnisses auf einer Wechselfestplatte auflisten und entfernen. Aber ich habe "Eingabe- / Ausgabefehler" erlebt:

Ich habe mich gefragt, was das Problem ist?

Wie kann ich das Verzeichnisbild und seinen gesamten Inhalt wiederherstellen oder entfernen?

Mein Betriebssystem ist Ubuntu 12.04 und die Wechselfestplatte hat ein NTFS-Dateisystem. Andere Verzeichnisse, die kein Bild auf der Wechselfestplatte enthalten oder darin enthalten, funktionieren einwandfrei.

Letzter Teil der Ausgabe von dmesg, nachdem ich versucht habe, den Inhalt des Verzeichnisses aufzulisten:


Wie kann ich stdout an mehrere Befehle senden?

Es gibt einige Befehle, die die Eingabe filtern oder darauf reagieren und sie dann als Ausgabe weitergeben, ich denke normalerweise an stdout - aber einige Befehle nehmen einfach die stdin und machen alles, was sie damit machen, und geben nichts aus.

Ich kenne OS X am besten und so fallen mir sofort zwei ein: pbcopy und pbpaste - die Mittel zum Zugriff auf die Systemzwischenablage.

Wie auch immer, ich weiß, dass ich den tee-Befehl verwenden kann, wenn ich stdout nehmen und die Ausgabe ausspucken möchte, um sowohl zu stdout als auch zu einer Datei zu gelangen. Und ich weiß ein wenig über Xargs, aber ich glaube nicht, dass das das ist, wonach ich suche.

Ich möchte wissen, wie ich stdout aufteilen kann, um zwischen zwei (oder mehr) Befehlen zu wechseln. Zum Beispiel:

Es gibt wahrscheinlich ein besseres Beispiel als dieses, aber ich bin wirklich daran interessiert zu wissen, wie ich stdout an einen Befehl senden kann, der es nicht weiterleitet, und dabei zu verhindern, dass stdout "stummgeschaltet" wird - ich frage nicht, wie man ein cat a file und grep einen Teil davon und kopiere ihn in die Zwischenablage - die spezifischen Befehle sind nicht so wichtig.

Außerdem - ich frage nicht, wie man dies an eine Datei und stdout sendet - dies kann eine "doppelte" Frage sein (sorry), aber ich habe etwas gesucht und konnte nur ähnliche finden, die fragten, wie man zwischen stdout und a aufteilt Datei - und die Antworten auf diese Fragen schienen tee zu sein, was meiner Meinung nach nicht für mich funktionieren wird.

Schließlich fragen Sie sich vielleicht: "Warum nicht einfach pbcopy zum letzten Ding in der Pipeline-Kette machen?" und meine Antwort ist 1) Was ist, wenn ich es verwenden möchte und trotzdem die Ausgabe in der Konsole sehen möchte? 2) Was ist, wenn ich zwei Befehle verwenden möchte, die stdout nicht ausgeben, nachdem sie die Eingabe verarbeitet haben?

Oh, und noch etwas - mir ist klar, dass ich ein T-Stück und eine benannte Pipe ( mkfifo ) verwenden könnte, aber ich hatte gehofft, dass dies inline, kurz und bündig, ohne vorheriges Setup erfolgen könnte :)


PL2303/PL2303X USB-Serieller Treiber

Ich habe einen USB-Seriell-Adapter mit dem PL2303X-Chip, um Hardware an einen Linux-Host anzuschließen. Das Gerät scheint über lsusb verbunden zu sein, ich kann jedoch keine Daten senden und empfangen. Ich habe versucht, beim Senden von Befehlen Daten mit moserial und putty zu senden / zu empfangen, es werden keine Antwortdaten zurückgegeben und ich bemerke keine Änderungen in dmesg oder /var/log/syslog .

Derselbe USB-Seriell-Adapter verbindet und funktioniert auf demselben Dell Laptop-Modell mit Windows 10 unter Windows kann er Befehle empfangen und Daten zurückgeben, die mit den folgenden Porteinstellungen konfiguriert wurden.

Ich möchte die folgenden Porteinstellungen verwenden, obwohl ich mit Moserial und Putty erfolglos Variationen der folgenden ausprobiert habe (d. h. keine Parität, unterschiedliche Baudraten, Hardware-/Software-Handshake usw.):

Windows funktioniert auch mit der Änderung der obigen Einstellungen (d. h. keine Parität, 7 Datenbits, niedrigere/höhere Baudrate usw.).

Ich muss in der Lage sein, Befehle zu senden und Daten zu empfangen, ähnlich wie das Gerät unter Windows funktioniert, vorzugsweise mit den oben genannten Porteinstellungen.

Irgendwelche Ideen, wie man das beheben oder debuggen kann? Ich schätze es.

lsusb-Ausgang identifiziert das Gerät als Bus 001 Gerät 016: ID 067b:2303 Prolific Technology, Inc. PL2303 Serial Port

Ich glaube, der Adapter hat den PL2303X-Chip anstelle von PL2303 (Quelle: PL2303 & Pl2303x USB-Seriell-Gerät).

Ich bemerke die Meldungen "kein MTP-Gerät" und "unhandled action 'bind'" in /var/log/syslog :

Ich habe einen alten Patch im Linux-Kernelmodul-Patch für den Prolific PL-2303X USB-Seriell-Adapter gefunden, obwohl er erwähnt, dass der Hauptkernelbaum PL-2303X-Unterstützung ab 2.6.8 enthält.

dmesg nach dem Einstecken des Geräts:

Habe auch den Fehler beim Senden von break = -19 Nachricht unten gesehen, habe aber Probleme beim Reproduzieren:


Ich habe diese Frage bei Stackoverflow gesehen, aber keine der Antworten hat mir gefallen, und es ist wirklich eine Frage, die sowieso hier auf U&L stehen sollte.

Grundsätzlich wird für jede Datei auf dem Dateisystem ein Inode verwendet. Wenn Ihnen die Inodes ausgehen, bedeutet dies im Allgemeinen, dass Sie viele kleine Dateien herumliegen haben. Die Frage lautet also wirklich: "Welches Verzeichnis enthält eine große Anzahl von Dateien?"

In diesem Fall ist das Dateisystem, das uns wichtig ist, das Root-Dateisystem / , daher können wir den folgenden Befehl verwenden:

Dadurch wird eine Liste aller Verzeichnisse im Dateisystem mit der Anzahl der Dateien (und Unterverzeichnisse) in diesem Verzeichnis als Präfix erstellt. Somit befindet sich das Verzeichnis mit der größten Anzahl von Dateien ganz unten.

In meinem Fall ergibt sich folgendes:

Im Grunde verbraucht /var/spool/postfix/maildrop alle Inodes.

* Beachten Sie, dass diese Antwort drei Vorbehalte hat, die mir einfallen. Es behandelt nichts mit Zeilenumbrüchen im Pfad richtig. Ich weiß, dass mein Dateisystem keine Dateien mit Zeilenumbrüchen hat, und da dies nur für den menschlichen Gebrauch verwendet wird, lohnt sich das potenzielle Problem nicht, und man kann immer durch ersetzen und die Optionen -z für die Sortierung und Uniq verwenden Befehle oben wie folgt:

Optional können Sie dem Befehl head -zn10 hinzufügen, um die 10 am häufigsten verwendeten Inodes zu erhalten.

Es funktioniert auch nicht, wenn die Dateien auf eine große Anzahl von Verzeichnissen verteilt sind. Dies ist jedoch nicht wahrscheinlich, daher halte ich das Risiko für akzeptabel. Es zählt auch harte Links zu einer gleichen Datei (also mit nur einem Inode) mehrmals. Auch hier ist es unwahrscheinlich, dass es zu falsch positiven Ergebnissen kommt*

Der Hauptgrund, warum mir keine der Antworten auf die Stackoverflow-Antwort gefallen hat, ist, dass sie alle Dateisystemgrenzen überschreiten. Da mein Problem auf dem Root-Dateisystem lag, bedeutet dies, dass es jedes einzelne gemountete Dateisystem durchquert. Das Werfen von -xdev auf die find-Befehle würde nicht einmal richtig funktionieren.
Die am meisten positive Antwort ist beispielsweise diese:

Wenn wir dies stattdessen ändern zu

Obwohl /mnt/foo ein Mount ist, ist es auch ein Verzeichnis im Root-Dateisystem, sodass es in find auftaucht. -xdev -type d , und dann wird es an ls -a $i übergeben, das in den Mount eintaucht.

Der Fund in meiner Antwort listet stattdessen das Verzeichnis jeder einzelnen Datei auf dem Mount auf. Also im Grunde mit einer Dateistruktur wie:


Schlussfolgerungen

Die Nanopore-Sequenzierung ist eine sich schnell entwickelnde Technologie sowohl hinsichtlich der Sequenzierungstechnologie als auch der Datenanalyse. Für die SV-Analyse wurden mehrere neue Aligner und SV-Caller entwickelt, um die lang gelesenen Sequenzierungsdaten zu nutzen. Darüber hinaus können auch montagebasierte Ansätze zur SV-Identifikation verwendet werden. Wir haben einen Workflow zur Auswertung von Mappern und SV-Callern etabliert. Wir haben festgestellt, dass die Leistung der SV-Anrufer zwischen den SV-Typen variiert. Daher sind unsere Empfehlungen auf die spezifischen Anwendungen zugeschnitten. Für eine erste Analyse empfehlen wir minimap2 und Sniffles aufgrund ihrer hohen Geschwindigkeit und relativ ausgewogenen Leistung beim Aufrufen von Einfügungen und Löschungen. Für eine detailliertere Analyse empfehlen wir, mehrere Tools auszuführen und deren Ergebnisse zu integrieren, um die beste Leistung zu erzielen. Wenn ein qualitativ hochwertiges True-Set definiert werden kann, kann ein maschineller Lernansatz, wie der hier vorgeschlagene, verwendet werden, um den Call-Set weiter zu verbessern. Die meisten Analysewerkzeuge für die Nanoporen-Sequenzierung wurden erst kürzlich entwickelt, und sowohl die Genauigkeit als auch die Empfindlichkeit können verbessert werden. Wir erwarten, dass sich Ressourcen von ONT und der Nanoporen-Sequenzierungs-Community ansammeln, wenn sich die Technologie verbessert und die Benutzerbasis wächst. Wenn mehr Daten generiert werden, stehen bessere Benchmark-Aufrufsätze zur Verfügung, um die Werkzeugleistung genauer zu bewerten und die zukünftige Werkzeugentwicklung zu erleichtern.


3 Antworten 3

Was Sie haben, ist eine Multithread-Anwendung, in der ein Thread einen Kernel-Bug gefunden zu haben scheint.

Einige Analyse des Fehlers

Sie haben versucht, den Prozess mongod mit der ID 1160 zu beenden. Der Haupt-Thread mit der ID 1160 befindet sich in einem Zombie-Zustand und wartet darauf, dass die anderen Threads im Prozess sterben.

Der Thread ftdc mit der ID 1247 ist beim Aufruf des madvise-Systemaufrufs irgendwann auf einen Kernel-Bug gestoßen, der in einer Endlosschleife endete.

Der Kernel hat einen Watchdog, der den hängengebliebenen Thread bemerkt und einen Stacktrace im Kernel-Log protokolliert. Der Stacktrace enthielt den Namen des Threads. Da der Name des Threads und des Prozesses in diesem Fall unterschiedlich waren, war die Verbindung zwischen den beiden aus dem Stacktrace nicht sofort ersichtlich.

Dieser Thread war wahrscheinlich in diesem Zustand stecken geblieben, bevor Sie überhaupt versucht haben, Mongod zu beenden.

Als Sie später echo l > /proc/sysrq-trigger ausgeführt haben, wurde erneut ein Stacktrace für den hängengebliebenen Thread protokolliert. Die beiden Stacktraces sind völlig identisch, daher kann es sehr gut sein, dass sie die ganze Zeit an der gleichen Stelle stecken geblieben sind.

Fehler melden

Was Sie tun müssen, ist einen Fehler gegen den Kernel einzureichen. Denken Sie daran, die Protokollausgabe von dem ersten Mal einzuschließen, als der Watchdog erkannte, dass der Thread hängen geblieben ist.

Neustart des Systems

Um dieses System wieder in einen guten Zustand zu versetzen, müssen Sie neu starten. Und es besteht ein erhebliches Risiko, dass ein sauberes Herunterfahren nicht möglich ist.

Wenn Sie versuchen, ein sauberes Herunterfahren zu versuchen, benötigen Sie möglicherweise physischen Zugriff auf die Maschine, um sie zurückzusetzen, es sei denn, Sie haben eine Möglichkeit, die Maschine aus der Ferne aus- und wieder einzuschalten.

Sie können einen unsauberen Neustart mit echo b > /proc/sysrq-trigger versuchen, der ungefähr so ​​störend ist, wie die Stromversorgung vom Computer zu reißen. Es wird das Szenario vermeiden, in dem ein versuchter sauberer Shutdown stecken bleibt und Sie nicht mehr per SSH auf den Computer zugreifen können.

Was auch immer Sie erwarten, dass beim Booten eine Dateisystemprüfung erforderlich ist. Bevor Sie also versuchen, den Computer in irgendeiner Weise herunterzufahren, sollten Sie die Dienste stoppen, die wichtige Daten auf die Festplatte schreiben, und einen Synchronisierungsbefehl ausführen.

Es besteht die Gefahr, dass ein Synchronisierungsbefehl hängen bleibt. Da der Stacktrace des festgefahrenen Prozesses jedoch keine Dateisystem- oder E/A-bezogenen Daten enthält, halte ich dieses Risiko für gering.

Es besteht auch die Gefahr, dass Sie aufgrund von Inkonsistenzen im Dateisystem physischen Zugriff auf den Computer benötigen, um ihn durch den Start zu bringen. Die Wahrscheinlichkeit dafür ist jedoch geringer als die Wahrscheinlichkeit, dass ein versuchter sauberer Shutdown stecken bleibt.


Ausgabe von clustalo auf (1.2.1) auf Ubuntu 14.04 - Biologie

phylo-node: Ein Molecular Phylogenetic Toolkit mit Node.js

Anforderungsmodul, zum Beispiel:

Stellen Sie sicher, dass sich die ausführbaren Dateien in Ihrem $PFAD befinden

Sequence Accession Numbers werden von der Kommandozeile getrennt durch ein Leerzeichen (kein Komma) gesammelt.

Node verwendet NCBI-E-Dienstprogramme, um Sequenzen im fastA-Format herunterzuladen:

Grundlegende Verwendung: node app.js inputfile [Liste der durch Leerzeichen getrennten Zugangsnummern]

Abrufen von Sequenzinformationen im ASN.1-Format

Sequence Accession Numbers werden gemäß den obigen fastA-Sequenzen unter Verwendung der Methode genbank_json gesammelt:

Grundlegende Verwendung: node app.js inputfile [Liste der durch Leerzeichen getrennten Zugangsnummern]

Ausführbare Dateien herunterladen:

Grundlegende Verwendung: Knoten app.js-URL

Notiz: Objekte für andere Tools wie PhyML, Clustal Omega und MUSCLE enthalten ihre eigenen Methoden zum Herunterladen von Binärdateien (siehe unten)

Grundlegende Verwendung:

Zeigen Sie den Browser auf localhost:8080

Notiz: Um einen JBrowse-Server zu erstellen, sollte dieser gemäß den hier beschriebenen Entwicklerrichtlinien heruntergeladen und konfiguriert werden

Grundlegende Verwendung: Knoten app.js Indexdatei -U fastQ-reads

Grundlegende Verwendung: node app.js path-to-jar input-file [beliebige Flags einfügen (von Flags unten)]

FLAGGE EINZELHEITEN
BELEUCHTUNGSCLIP Schneiden Sie Adapter und andere illumina-spezifische Sequenzen aus dem Read
SCHIEBEFENSTER Führen Sie einen Schiebefenstertrimm durch
FÜHREND Schneiden Sie Basen zu Beginn eines Lesevorgangs ab, wenn die Qualität unter einem Schwellenwert liegt
NACHFOLGEN Schneiden Sie Basen am Ende eines Lesevorgangs ab, wenn die Qualität unter einem Schwellenwert liegt
ERNTE Schneiden Sie den Read auf eine bestimmte Länge
KOPFSCHNEE Schneiden Sie die angegebene Anzahl von Basen vom Beginn des Lesens an
MINLEN Den Lesevorgang verwerfen, wenn er unter einer bestimmten Länge liegt
TOPHRED33 Konvertieren Sie Qualitätswerte in Phred-33
TOPHRED64 Konvertieren Sie Qualitätswerte in Phred-64

Notiz: muss über eine Java-Laufzeitumgebung und ein Trimmomatic-Jar verfügen

Laden Sie PhyML mit diesem Befehl herunter

Grundlegende Verwendung: node app.js inputfile [beliebige Flags einfügen (von Flags unten)]

FLAGGE GEBIET
-D Datentyp
-Q
-n nb_data_sets
-B int
-m Modell
-F e
-T ts/tv_verhältnis
-v prop_invar
-C nb_subst_cat
-ein Gamma
-S Bewegung
-u user_tree_file
'tlr'
--rand_start
--n_rand_starts num
--r_seed num
--print_site_lnl
--print_trace

Grundlegende Verwendung: Knoten app.js Dateiname [-flags (aus Tabelle unten)]

FLAGGEN
-format_ausgabe
-default_version=1
-io_version=4
-p3_settings_file= file_path
-echo_settings_file
-strict_tags
-output= file_path
-error= file_path

Muskel ausführbare Datei herunterladen

Grundlegende Verwendung: node app.js inputfile [Fügen Sie alle Flags ein, denen ein '-'-Zeichen vorangestellt und durch ein Leerzeichen getrennt ist (von Flags unten)]

FLAGGE FUNKTION
-diagnostizieren Diagonalen finden (schneller für ähnliche Folgen)
-html Ausgabe im HTML-Format schreiben (Standard FASTA)
-msf Ausgabe im GCG MSF-Format schreiben (Standard FASTA)
-clw Ausgabe im CLUSTALW-Format schreiben (Standard FASTA)
-clwstrict Wie -clw, mit 'CLUSTAL W (1.81)' Header
-ruhig Schreiben Sie keine Fortschrittsnachrichten an stderr

Ausführbare Clustal Omega-Datei herunterladen

Clustal Omega-Programm ausführen

Grundlegende Verwendung: node app.js inputfile [fügen Sie alle Flags ein, denen ein '--'-Zeichen vorangestellt und durch ein Leerzeichen getrennt ist]

FLAGGE FUNKTION
--voll Verwenden Sie die vollständige Distanzmatrix für die Leitbaumberechnung (slow mBed ist Standard)
--full-iter Verwenden Sie die vollständige Distanzmatrix für die Leitbaumberechnung während der Iteration (mBed ist Standard)
--Clustergröße Ausgabe im GCG MSF-Format schreiben (Standard FASTA)
--use-kimura Kimura-Abstandskorrektur für ausgerichtete Sequenzen verwenden (Standard nein)
--Prozent-ID Entfernungen in prozentuale Identitäten umwandeln (Standard nein)
--outfmt
--resno im Clustal-Format Restnummern drucken (Standard nein)
--wickeln Anzahl der Reste vor Zeilenumbruch in der Ausgabe
--Ausgabereihenfolge
--iter Anzahl der Iterationen (kombinierter Leitbaum/HMM)
--max-guidetree-iterations Maximale Guide-Tree-Iterationen
--max-hmm-iterationen Maximale Anzahl von HMM-Iterationen

Grundlegende Verwendung: node app.js inputfile [Fügen Sie alle Flags ein, denen ein '-'-Zeichen vorangestellt und durch ein Leerzeichen getrennt ist]

FLAGGE FUNKTION
-gpo Strafe für Lückenöffnung (Standard 6.0).
-gpe Strafe für Lückenerweiterung (Standard 0.9).
-P Wu-Manber-Algorithmus, der sowohl in der Distanzberechnung als auch in der dynamischen Programmierung verwendet wird
-w Wu-Manber-Algorithmus wird überhaupt nicht verwendet
-F schnelle heuristische Ausrichtung
-Q 'leise' - es werden keine Nachrichten an den Standardfehler gesendet

Grundlegende Verwendung: node app.js input.aln input.fasta [beliebige Flags von unten einfügen]

FLAGGE FUNKTION
-h Zeig Hilfe
-nur blockieren Nur benutzerdefinierte Blöcke anzeigen
-Ausgang (clustal,paml,fasta,codon) Ausgabeformat, Standard = clustal
-keine Lücke Entferne Spalten mit Lücken und Inframe-Stopcodons
-nomismatch nicht übereinstimmende Codons (Fehlpaarung zwischen pep und cDNA) aus der Ausgabe entfernen
-Kodontisch 1 (Standard),2,3,4,5,6,9,10,11,12,13,14,15,16,21,22,23 NCBI GenBank-Codon-Tabelle
-html HTML-Ausgabe (nur für den Webserver)
-nostderr Keine STDERR-Nachrichten (nur für den Webserver)

Notiz: muss Perl installiert haben

Grundlegende Verwendung: node app.js input.paml input.trees [beliebige Flags von unten einfügen]

FLAGGE FUNKTION
-reoptimieren 0 (nein), 1 (ja), 2 (Verzweigungslängen auf zufällige Werte setzen)
-kappa Wert für kappa
-Omega Wert für Omega (dN/dS)
-branopt 0: fest, 1: optimieren, 2: proportional
-codonf 0: F61/F60 1: F3x4 2: F1x4
-Frequenztyp 0, 1, 2, 3
-positive_only 0(nein) oder 1(ja)
-nukleof 0: keine, 1: um eine Konstante N_ anpassen.
-aminof 0 (konstant), 1, 2
-Frequenztyp 0, 1, 2, 3
-timem Zusammenfassung der verwendeten Echtzeit- und CPU-Zeit 1:ja 0:nein
-überspringen Standortweise Schätzung von Omega- überspringen

Grundlegende Verwendung: Knoten app.js input.cnt [alle Parameter werden von cnt-Datei festgelegt]

Grundlegende Verwendung: node app.js path-to-jar input-file [beliebige Flags einfügen (von Flags unten)]

FLAGGE EINZELHEITEN
-ich Ausrichtung_Dateiname
-T Baum_Dateiname (optional)
output_filename (optional)
-[Matrix] Matrix einschließen (Aminosäure)
-ICH Modelle mit einem Anteil unveränderlicher Standorte
-G Ratenvariation zwischen Websites und Kategorien
-ICH G Modelle mit +I und +G
-alle-Verteilungen Ratenvariation zwischen Websites, Kategorien und beidem
-ncat Anzahl der Kategorien
-F Modelle mit empirischer Häufigkeitsschätzung
-AIC Akaike-Informationskriterium
-BIC Bayessches Informationskriterium
-AICC Korrigiertes Akaike-Informationskriterium
-DT Entscheidungstheoretisches Kriterium
-alle 7-Frame-Vergleichstabelle
-S Modus der Optimierungsstrategie: [Standard: 0]
-S Baumsuchoperation für ML-Suche
-t1 Newick-Baum des besten Modells anzeigen
-t2 ASCII-Baum des besten Modells anzeigen
-tc Konsensbaum mit angegebenem Schwellenwert anzeigen
-fäden Anzahl der zur Berechnung angeforderten Threads
-ausführlich Ausführlicher Modus [Standard: false]

Notiz: muss eine Java-Laufzeitumgebung und ein ProtTest3-Jar haben

Grundlegende Verwendung: node app.js path-to-jar input-file -o output-file [beliebige Flags einfügen (von Flags unten)]

FLAGGE EINZELHEITEN
-ein Schätzen Sie die modellgemittelte Phylogenie für jedes aktive Kriterium
-T Basisbaum für Likelihood-Berechnungen (z. B. -t BIONJ)
Ausgabedatei
-ich Modelle mit einem Anteil unveränderlicher Websites einschließen
-Maschinendatei Ruft die Prozessoren pro Host aus einer Maschinendatei ab
-g numberOfRateCategories
-getPhylip Konvertiert die Eingabedatei in das phylip-Format und beendet es
-G Schwelle
-h VertrauenIntervall
-AIC Akaike-Informationskriterium
-BIC Bayessches Informationskriterium
-AICc Korrigiertes Akaike-Informationskriterium
-hLRT Hierarchische Likelihood-Quotienten-Tests durchführen
-DT Berechnen Sie das entscheidungstheoretische Kriterium
-F Modelle mit ungleichen Basisfrequenzen einschließen
-H Informationskriterium für Clustering-Suche
-n logSuffix
Setzt die Hypothesenreihenfolge für die hLRTs
-P Berechnen Sie die Parameterwichtigkeiten
-tr Anzahl der zur Berechnung angeforderten Threads
-v Modellmittelung und Parameterbedeutungen durchführen
-S Legt die Anzahl der Substitutionsschemata fest
-u Baumdatei
-uLNL Berechne Delta AIC,AICc,BIC gegen die uneingeschränkte Wahrscheinlichkeit
-w Druckt den PAUP-Block aus
-z Strenger Konsenstyp für modellgemittelte Phylogenie

Notiz: muss über eine Java-Laufzeitumgebung und jModelTest2 jar verfügen

Befehle können in Reihe verkettet werden, um Daten zwischen Anwendungen weiterzuleiten:

Pipes dir enthält das Modul für Piping sowie Beispieldateien. Beispiel ausführen:

pipe_example.js leitet die Ausgabe eines NCBI-Fetch-API-Aufrufs in die Alignment-Software MUSCLE und richtet die DNA mit den Standardeinstellungen aus

Notiz: muss MUSCLE in $PATH für das Pipe-Beispiel haben

phylo-node wurde erfolgreich getestet auf:

  • Microsoft Windows 7 Enterprise Version 6.1
  • MacOSX El Capitan ver.10.11.5
  • Linux Ubuntu 64-Bit ver.14.04 LTS

So stellen Sie sicher, dass alle Entwicklungsabhängigkeiten installiert sind:

Notiz: Wenn Sie beim Ausführen von Tests einen Berechtigungsfehler erhalten, müssen Sie möglicherweise chmod mocha

Skinner M. E., Uzilov A. V., Stein L. D., Mungall C. J., Holmes I. H. (2009). JBrowse: ein Genombrowser der nächsten Generation. Genomforschung, 19(9): 1630-1638

Langmead B, Salzberg S. (2012). Schnelle Gapped-Read-Ausrichtung mit Bowtie 2. Nature Methods, 49(4):357-9

Bolger, A.M., Lohse, M., &. Usadel, B. (2014). Trimomatic: Ein flexibler Trimmer für Illumina-Sequenzdaten. Bioinformatik, btu170

Guindon S., Dufayard J.F., Lefort V., Anisimova M., Hordijk W., Gascuel O. (2010). Neue Algorithmen und Methoden zur Schätzung von Maximum-Likelihood-Phylogenien: Bewertung der Leistung von PhyML 3.0. Systematische Biologie, 59(3):307-21

Untergasser A, Cutcutache I, Koressaar T, Ye J, Faircloth BC, Remm M und Rozen SG. (2012). Primer3 - neue Fähigkeiten und Schnittstellen. Nukleinsäuren Res. 40(15):e115

Edgar, R. C. (2004) MUSCLE: Multiple Sequence Alignment mit hoher Genauigkeit und hohem Durchsatz. Nukleinsäuren Res. 32(5):1792-1797

Edgar, R. C. (2004) MUSCLE: ein multiples Sequenz-Alignment-Verfahren mit reduzierter Zeit- und Raumkomplexität. BMC Bioinformatik, (5)113

Sievers F, Wilm A, Dineen DG, Gibson TJ, Karplus K, Li W, Lopez R, McWilliam H, Remmert M, Söding J, Thompson JD, Higgins DG (2011). Schnelle, skalierbare Generierung hochwertiger Protein-Mehrfachsequenz-Alignments mit Clustal Omega. Molekulare Systembiologie 7:539

Lassmann T, Sonnhammer EL. (2005). Kalign – ein genauer und schneller Alignmentalgorithmus für mehrere Sequenzen. BMC Bioinformatik. 126:298

Suyama M, Torrents D, Bork P (2006). PAL2NAL: robuste Umwandlung des Proteinsequenz-Alignments in die entsprechenden Codon-Alignments. Nukleinsäuren Res. 34:W609-W612

Massingham T, Goldman N (2005)Nachweis von Aminosäurestellen unter positiver Selektion und aufreinigender Selektion. Genetik 169: 1853-1762

Yang, Z (2007) PAML 4: phylogenetische Analyse nach maximaler Wahrscheinlichkeit. Mol Biol Evol. 24(8):1586-91.

Yang, Z (1997) PAML: ein Programmpaket für die phylogenetische Analyse nach maximaler Wahrscheinlichkeit. Comput Appl Biosci. 13(5):555-6

Darriba D, Taboada GL, Doallo R, Posada D. (2011). ProtTest 3: Schnelle Auswahl der am besten geeigneten Modelle der Proteinevolution. Bioinformatik, 27:1164-1165

Darriba D, Taboada GL, Doallo R, Posada D. (2012). jModelTest 2: mehr Modelle, neue Heuristiken und paralleles Rechnen. Naturmethoden 9(8), 772

Alle Beiträge sind willkommen.

Wenn Sie ein Problem oder einen Vorschlag haben, öffnen Sie bitte hier ein Problem.

Copyright (c) 2016, dohalloran

Hiermit wird jeder Person, die eine Kopie dieser Software und der zugehörigen Dokumentationsdateien (die "Software") erhält, kostenlos die Erlaubnis erteilt, mit der Software ohne Einschränkung zu handeln, einschließlich und ohne Einschränkung der Rechte zur Nutzung, zum Kopieren, Ändern, Zusammenführen , Kopien der Software zu veröffentlichen, zu verteilen, unterzulizenzieren und/oder zu verkaufen und Personen, denen die Software zur Verfügung gestellt wird, dies zu gestatten, vorbehaltlich der folgenden Bedingungen:

Der obige Urheberrechtshinweis und dieser Genehmigungshinweis müssen in allen Kopien oder wesentlichen Teilen der Software enthalten sein.

DIE SOFTWARE WIRD "WIE BESEHEN" BEREITGESTELLT, OHNE JEGLICHE AUSDRÜCKLICHE ODER STILLSCHWEIGENDE GEWÄHRLEISTUNG, EINSCHLIESSLICH, ABER NICHT BESCHRÄNKT AUF DIE GEWÄHRLEISTUNG DER MARKTFÄHIGKEIT, EIGNUNG FÜR EINEN BESTIMMTEN ZWECK UND NICHTVERLETZUNGSVERLETZUNG. IN KEINEM FALL HAFTEN DIE AUTOREN ODER URHEBERRECHTSINHABER FÜR JEGLICHE ANSPRÜCHE, SCHÄDEN ODER ANDERE HAFTUNG, OB AUS VERTRAGLICHEM, SCHLECHTER ODER ANDERWEITIGEM, DIE AUS, AUS ODER IN VERBINDUNG MIT DER SOFTWARE ODER DER VERWENDUNG ODER ANDEREN HANDELN IN SOFTWARE.


Пакеты программ в "fokal", Подсекция science

r57554-5) [Universum] Apertium-Übersetzungsdaten für das walisisch-englische Paar Apertium-Dan (0.6.0-2) [Universum] Apertium einsprachige Daten für Dänisch apertium-dan-nor (1.4.1-1) [Universum] Apertium-Übersetzungsdaten für das dänisch-norwegische Paar apertium-dev (3.6.1-1build2) [Universum] Entwicklungstools und Bibliothek für Apertium apertium-en-gl (0.5.2

r57551-3) [Universum] Apertium-Übersetzungsdaten für das englisch-galizische Paar Apertium-eng-cat (1.0.1-1) [Universum] Apertium-Übersetzungsdaten für das englisch-katalanische Paar apertium-eo-en (1.0.0

r63833-3) [Universum] Sprachdaten von Apertium zur Übersetzung zwischen Esperanto und Englisch apertium-eo-fr (0.9.0

r57551-3) [Universum] Apertium-Translationsdaten für das Esperanto-Französisch-Paar Apertium-es-ast (1.1.0

r51165-3) [Universum] Apertium-Übersetzungsdaten für das spanisch-asturische Paar apertium-es-it (0.2.0

r78826-2) [Universum] Übergangs-Dummy-Paket für apertium-spa-ita apertium-eu-de (0.3.1

r56205-3) [Universum] Apertium-Übersetzungsdaten für das Baskisch-Englisch-Paar Apertium-Eval-Übersetzer (1.2.1-2) [Universum] Bewerten Sie die Ausgabe der maschinellen Übersetzung anhand der Referenz apertium-fra (1.5.0-1) [Universum] Einsprachige Apertium-Daten für Französisch apertium-fra-cat (1.7.0-1) [Universum] Apertium-Translationsdaten für das französisch-katalanische Paar Apertium-hbs (0.5.0

r68212-3) [Universum] Apertium einsprachige Daten für Serbokroatisch apertium-hbs-eng (0.1.0

r57598-2) [Universum] Apertium-Übersetzungsdaten für das Serbokroatisch - Englisch-Paar apertium-hbs-mkd (0.1.0

r76450-4) [Universum] Apertium-Translationsdaten für das Serbo-Kroatisch-Mazedonische Paar Apertium-hbs-slv (0.1.0

r59294-2) [Universum] Apertium-Translationsdaten für das serbokroatisch-slowenische Paar Apertium-hin (0.1.0

r59158-2) [Universum] Apertium einsprachige Daten für Hindi apertium-id-ms (0.1.1

r57551-2) [Universum] Apertium-Translationsdaten für das indonesisch-malaiische Paar Apertium-is-sv (0.1.0

r76450-3) [Universum] Apertium-Translationsdaten für das isländisch-schwedische Paar Apertium-isl (0.1.0

r65494-2) [Universum] Einsprachige Apertium-Daten für isländisch apertium-isl-eng (0.1.0

r66083-3) [Universum] Apertium-Übersetzungsdaten für das Isländisch-Englisch-Paar apertium-ita (0.10.0

r82237-2) [Universum] Apertium einsprachige Daten für italienisches Apertium-kaz (0.1.0

r61338-2) [Universum] Apertium einsprachige Daten für Kasachisch apertium-kaz-tat (0.2.1

r57554-2) [Universum] Apertium-Übersetzungsdaten für das kasachisch-tatarische Paar Apertium-Lex-Tools (0.2.3-1build2) [Universum] Beschränkungsbasiertes lexikalisches Auswahlmodul apertium-mk-bg (0.2.0

r49489-3) [Universum] Apertium-Übersetzungsdaten für das mazedonisch-bulgarische Paar apertium-mk-en (0.1.1

r57554-3) [Universum] Apertium-Übersetzungsdaten für das Mazedonisch-Englisch-Paar apertium-mlt-ara (0.2.0

r62623-2) [Universum] Apertium-Translationsdaten für das maltesisch-arabische Paar Apertium-nno (1.0.0-2) [Universum] Apertium einsprachige Daten für das norwegische Nynorsk apertium-nno-nob (1.3.0-1) [Universum] Apertium-Translationsdaten für das norwegische Nynorsk-norwegische Bokmål-Paar Apertium-nob (1.0.0-2) [Universum] Einsprachige Apertium-Daten für das norwegische Bokmål apertium-oci (0.1.0-1) [Universum] Apertium einsprachige Daten für Okzitanisch apertium-oci-fra (0.3.0-1) [Universum] Apertium-Translationsdaten für das okzitanisch-französische Paar Apertium-pol (0.1.1-2) [Universum] Einsprachige Apertium-Daten für das polnische Apertium-por-cat (0.9.0-1) [Universum] Apertium-Übersetzungsdaten für das portugiesisch-katalanische Paar Apertium-rekursiv (0.0.1-1build1) [Universum] Apertium rekursives Strukturtransfermodul Apertium-rus (0.2.0

r82706-1) [Universum] Einsprachige Apertium-Daten für russisches Apertium-separable (0.3.3-1build1) [Universum] Neuordnung trennbarer/nicht zusammenhängender Mehrwörter apertium-sme-nob (0.6.0

r61921-2) [Universum] Apertium-Translationsdaten für das Nordsamisch-Norwegische Bokmål-Paar Apertium-Spa (1.1.0

r79716-2) [Universum] Apertium einsprachige Daten für Spanisch apertium-spa-arg (0.4.0

r64399-2) [Universum] Apertium-Übersetzungsdaten für das Spanisch-Aragonesische Paar Apertium-Spa-Katze (2.2.0-1) [Universum] Apertium-Übersetzungsdaten für das spanisch-katalanische Paar apertium-spa-ita (0.2.0

r78826-2) [Universum] Apertium-Übersetzungsdaten für das spanisch-italienische Paar Apertium-swe (0.8.0-2) [Universum] Apertium einsprachige Daten für Schwedisch apertium-swe-dan (0.8.1-1) [Universum] Apertium-Translationsdaten für das schwedisch-dänische Paar Apertium-swe-nor (0.3.1-1) [Universum] Apertium-Translationsdaten für das schwedisch-norwegische Paar Apertium-szl (0.1.0-1) [Universum] Apertium einsprachige Daten für schlesisches Apertium-tat (0.1.0

r60887-2) [Universum] Apertium einsprachige Daten für Tatar apertium-tur (0.2.0

r83161-2) [Universum] Apertium einsprachige Daten für türkisches Apertium-ukr (0.1.0

r82563-2) [Universum] Apertium einsprachige Daten für ukrainisches Apertium-urd (0.1.0

r61311-2) [Universum] Einsprachige Apertium-Daten für Urdu apertium-urd-hin (0.1.0

r64379-2) [Universum] Apertium-Translationsdaten für das Urdu-Hindi-Paar Aragorn (1.2.38-2) [Universum] tRNA- und tmRNA-Nachweis in Nukleotidsequenzen arb (6.0.6-4build1) [Multiversum] phylogenetische Sequenzanalyse-Suite - Hauptprogramm arb-common (6.0.6-4build1) [Multiversum] phylogenetische Sequenzanalyse-Suite - gemeinsame Dateien arden (1.0-5) [Universum] Spezifitätskontrolle für Read-Alignments unter Verwendung einer künstlichen Referenz-Ariba (2.14.4+ds-2build1) [Universum] Identifizierung von Antibiotikaresistenzen durch Montage art-nextgen-simulation-tools (20160605+dfsg-4) [Universum] Simulationstools zur Generierung synthetischer Sequenzierung der nächsten Generation liest art-nextgen-simulation-tools-profiles (20160605+dfsg-4) [Universum] Profile für Kunstsimulationstools artemis (17.0.1+dfsg-2) [Universum] Genombrowser und Annotationstool artfastqgenerator (0.0.20150519-3) [Universum] gibt künstliche FASTQ-Dateien aus, die von einem Referenzgenom abgeleitet wurden artfastqgenerator-examples (0.0.20150519-3) [Universum] gibt künstliche FASTQ-Dateien aus, die von einem Referenzgenom abgeleitet wurden (Beispiele) asdftool (2.5.1-1) [Universum] Befehlszeilentool zum Bearbeiten von wissenschaftlichen ASDF-Datendateien ase (3.19.0-1) [Universum] Atomic Simulation Environment Assemblytics (1.0+ds-2) [Universum] Strukturvarianten aus einer Genomassemblierung erkennen und analysieren Astroaufgaben (2.1) [Universum] Debian Astronomy Pure Blend (Aufgabenaufgaben) astromatic (1.2) [Universum] Astronomische Pipeline-Softwaresammlung Astrometrie-Daten-2mass (1.1) [Multiversum] Astrometry.net 2MASS Indexdateien Downloader astrometry-data-2mass-00 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (2'-2.8') astrometry-data-2mass-01 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (2.8'-4') astrometry-data-2mass-02 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (4'-5.6') astrometry-data-2mass-03 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (5.6'-8') astrometry-data-2mass-04 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (8'-11') astrometry-data-2mass-05 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (11'-16') astrometry-data-2mass-06 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (16'-22') astrometry-data-2mass-07 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (22'-30') astrometry-data-2mass-08-19 (1.1) [Multiversum] Astrometry.net 2MASS-Indexdateien-Downloader (30'-2000') astrometry-data-tycho2 (2-4) [Universum] Astrometry.net Tycho-2 Indexdateien astrometry-data-tycho2-07 (2-4) [Universum] Astrometry.net Tycho-2 Indexdateien (22'-30') astrometry-data-tycho2-07-bigendian (2-4) [Universum] Astrometry.net Tycho-2 Big-Endian-Indexdateien (22'-30') astrometry-data-tycho2-07-littleendian (2-4) [Universum] Astrometry.net Tycho-2 Little-Endian-Indexdateien (22'-30') astrometry-data-tycho2-08 (2-4) [Universum] Astrometry.net Tycho-2 Indexdateien (30'-44') astrometry-data-tycho2-08-bigendian (2-4) [Universum] Astrometry.net Tycho-2 Big-Endian-Indexdateien (30'-44') astrometry-data-tycho2-08-littleendian (2-4) [Universum] Astrometry.net Tycho-2 Little-Endian-Indexdateien (30'-44') astrometry-data-tycho2-09 (2-4) [Universum] Astrometry.net Tycho-2 Indexdateien (44'-60') astrometry-data-tycho2-09-bigendian (2-4) [Universum] Astrometry.net Tycho-2 Big-Endian-Indexdateien (44'-60') astrometry-data-tycho2-09-littleendian (2-4) [Universum] Astrometry.net Tycho-2 Little-Endian-Indexdateien (44'-60') astrometry-data-tycho2-10-19 (2-4) [Universum] Astrometry.net Tycho-2 Indexdateien (60'-2000') astrometry-data-tycho2-10-19-bigendian (2-4) [Universum] Astrometry.net Tycho-2 Big-Endian-Indexdateien (60'-2000') astrometry-data-tycho2-10-19-littleendian (2-4) [Universum] Astrometry.net Tycho-2 Little-Endian-Indexdateien (60'-2000') astrometry.net (0.78+dfsg-3build2) [Universum] Astrometrieplattenlöser Astronomischer-Almanach (5.6-6) [Universum] astronomischer Almanach - Planeten- und Sternpositionen Atropos berechnen (1.1.24+dfsg-1build1) [Universum] NGS-Read-Trimming-Tool, das spezifisch, empfindlich und schnell ist Augustus (3.3.3+dfsg-2build1) [Universum] Genvorhersage in eukaryotischen Genomen Augustus-Daten (3.3.3+dfsg-2build1) [Universum] Datendateien für AUGUSTUS Autodock (4.2.6-7build1) [Universum] Analyse der Ligandenbindung an die Proteinstruktur autodock-getdata (4.2.6-7build1) [Universum] Anweisungen für getData zum Sammeln von Verbindungen autodock-test (4.2.6-7build1) [Universum] Testdateien für AutoDock autodock-vina (1.1.2-5build3) [Universum] Andocken kleiner Moleküle an Proteine ​​Autogrid (4.2.6-7build1) [Universum] Bindung von Liganden an ihren Rezeptor-Autogrid-Test vorberechnen (4.2.6-7build1) [Universum] Testdateien für AutoGrid avce00 (2.0.0-7) [Universum] Konvertierung von ESRI Arcinfo Vector Coverage in das E00-Format avogadro (1.93.0-1) [Universum] Molekulares Grafik- und Modellierungssystem avogadro-utils (1.93.0-3) [Universum] Molecular Graphics and Modeling System (Bibliothek) Axe-Demultiplexer (0.3.3+dfsg-1) [Universum] Trie-basierte DNA-Sequenzierung Read Demultiplexer Bagel (1.2.2-1ubuntu1) [Universum] Computational Chemistry Package baitfisher (1.2.7+git20180107.e92dbf2+dfsg-1build1) [Universum] Softwarepaket zum Entwerfen von Hybrid-Anreicherungssonden Bali-Phy (3.4.1+dfsg-2build1) [Universum] Bayessche Inferenz von Ausrichtung und Phylogenie ballview (1.5.0+git20180813.37fc53c-4build2) [Universum] kostenloses molekulares Modellierungs- und molekulares Grafiktool bamtools (2.5.1+dfsg-5build1) [Universum] Toolkit zur Manipulation von BAM-Dateien (Genom-Alignment) Bandage (0.8.1-1build1) [Universum] Bioinformatik-Anwendung zum einfachen Navigieren in De-novo-Assembly-Graphen barrnap (0.9+dfsg-1) [Universum] schnelle ribosomale RNA-Vorhersage bart (0.5.00-1) [Universum] Tools für die computergestützte Magnetresonanztomographie Bart-View (0.1.00-2) [Universum] Viewer für mehrdimensionale komplexwertige Daten bbmap (38.79+dfsg-1) [Universum] Short Read Aligner und andere bioinformatische Tools bbmap-jni (38.79+dfsg-1) [Universum] Short-Read-Aligner und andere bioinformatische Tools - JNI-Bibliothek bcalm (2.2.1-2build1) [Universum] de Bruijn-Komprimierung in bcftools mit geringem Speicher (1.10.2-2) [Universum] Aufruf von genomischen Varianten und Manipulation von VCF/BCF-Dateien Beads (1.1.18+dfsg-4build1) [Universum] 2-DE-Elektrophoresegel-Bildpunkterkennung Beagle (5.1-191125+dfsg-1) [Universum] Genotyp-Calling, Genotyp-Phasing und Imputation von nicht-typisierten Markern beast-mcmc (1.10.4+dfsg-2) [Multiversum] Bayesianische MCMC phylogenetische Inferenz beast2-mcmc (2.6.0+dfsg-1) [Universum] Bayesianische MCMC phylogenetische Inferenz Bedops (2.4.37+dfsg-2build1) [Universum] leistungsstarke genomische Feature-Operationen bedtools (2.27.1+dfsg-4ubuntu1) [Universum] Dienstprogramm-Suite zum Vergleich genomischer Merkmale bedtools-test (2.27.1+dfsg-4ubuntu1) [Universum] Testdaten für das Bedtools-Paket belvu (4.44.1+dfsg-3build1) [Universum] Viewer für multiples Sequenz-Alignment und phylogenetisches Tool berkeley-express (1.5.3+dfsg-1build1) [Universum] Streaming-Quantifizierung für die Hochdurchsatz-Sequenzierung bio-eagle (2.4.1-1build2) [Universum] Haplotyp-Phasing innerhalb einer genotypisierten Kohorte oder unter Verwendung eines phasengesteuerten Referenzpanels Bio-Adler-Beispiele (2.4.1-1build2) [Universum] Beispiele für Bio-Adler Bio-Regenbogen (2.0.4+dfsg-1) [Universum] Clustering und Assembling von Short Reads für Bioinformatik biobambam2 (2.0.95-1) [Universum] Tools für die Biogenese der Alignment-Datei im Frühstadium (0,8-3) [Universum] künstliches Lebensprogramm, das die Evolution von Organismen simuliert bioperl (1.7.7-1) [Universum] Perl-Tools für die computergestützte Molekularbiologie bioperl-run (1.7.3-3) [Universum] BioPerl-Wrapper: Skripte Biosquid (1.9g+cvs20050121-11) [Universum] Dienstprogramme für die Biosyntax der biologischen Sequenzanalyse (1.0.0b-1) [Universum] Syntax-Highlighting für Computational Biology (Metapaket) biosyntax-common (1.0.0b-1) [Universum] Syntax-Highlighting für Computational Biology (allgemeine Dateien) biosyntax-example (1.0.0b-1) [Universum] Syntax-Highlighting für Computerbiologie (Beispiel) biosyntax-gedit (1.0.0b-1) [Universum] Syntax-Highlighting für Computerbiologie (gedit) biosyntax-less (1.0.0b-1) [Universum] Syntax-Highlighting für Computerbiologie (weniger) biosyntax-vim (1.0.0b-1) [Universum] Syntaxhervorhebung für Computerbiologie (vim) bitseq (0.7.5+dfsg-5build1) [Universum] Bayessche Inferenz von Transkripten aus Sequenzierungsdaten bitweise (0.40-1) [Universum] Interaktive bitweise Operation in ncurses blasr (5.3.3+dfsg-4build1) [Universum] Mapping der Einzelmolekül-Sequenzierung liest blast2 (1:2.9.0-2) [Universum] Übergangs-Dummy-Paket zu ncbi-blast+-legacy blimps-utils (3.9+ds-1) [Multiversum] blockiert Datenbank verbesserter Sucher blinken (4:19.12.3-0ubuntu1) [Universum] KDE-Version des elektronischen Simon-Memory-Spiels Blixem (4.44.1+dfsg-3build1) [Universum] interaktiver Browser von Sequenz-Alignments bmt (0.6-1) [Universum] Softwareanalyse-Benchmarking-Toolkit bodr (10-2) [Universum] Blue Obelisk Data Repository boinc-app-seti (8.00

svn4035-1build1) [Universum] [email protected] für den BOINC-Client boinc-app-seti-graphics (8.00

svn4035-1build1) [Universum] [email protected] für den BOINC-Client (mit Grafik) Bolt-lmm (2.3.4+dfsg-2build1) [Universum] Effiziente große Kohorten genomweite Bayesian Mixed-Model-Assoziationstests Bolt-lmm-Beispiel (2.3.4+dfsg-2build1) [Universum] Beispiele für Bolt-lmm-Boolektor (1.5.118.6b56be4.121013-1build1) [Universum] SMT-Solver für Bit-Vektoren und Arrays Bowtie (1.2.3+dfsg-4build1) [Universum] Ultraschnelle speichereffiziente Short Read Aligner Bowtie-Beispiele (1.2.3+dfsg-4build1) [Universum] Beispiele für Bowtie, den ultraschnellen speichereffizienten Short-Read-Aligner Bowtie2 (2.3.5.1-6build1) [Universum] ultraschneller speichereffizienter Short Read Aligner Bowtie2-Beispiele (2.3.5.1-6build1) [Universum] Beispiele für Bowtie2 Boxshade (3.3.1-13) [Universum] Pretty-Printing mehrerer Sequenz-Alignments bppphyview (0.6.1-1build1) [Universum] Bio++ Phylogenetic Viewer bppsuite (2.4.1-1build1) [Universum] Bio++ Programmsuite bppsuite-Beispiele (2.4.1-1build1) [Universum] Beispiele für die Bio++ Programmsuite brig (0.95+dfsg-3) [Universum] BLAST Ring Image Generator bwa (0.7.17-4) [Universum] Burrows-Wheeler Aligner cafeobj (1.6.0-2) [Universum] algebraische Spezifikation und Programmiersprache der neuen Generation cafeobj-mode (1.6.0-2) [Universum] Emacs-Hauptmodus zum Bearbeiten des CafeOBJ-Quellcodes caffe-tools-cpu (1.0.0+git20180821.99bd997-5build3) [Universum] Tools für schnelles, offenes Framework für Deep Learning (CPU_ONLY) caftools (2.0.2-2) [Multiversum] Pflege von DNA-Sequenz-Assemblies calculix-ccx (2.11-1build3) [Universum] Dreidimensionales strukturelles Finite-Elemente-Programm calculix-cgx (2.11+dfsg-1build1) [Universum] Calculix cgx ist ein 3-dimensionaler Pre- und Postprozessor für Fem Callisto (1.1.0-2) [Universum] Daemon für e-Callisto-Hardware camitk-actionstatemachine (4.1.2-4build1) [Universum] Pipeline-Wiedergabeanwendung für die CamiTK-Bibliothek camitk-config (4.1.2-4build1) [Universum] Toolkit für computergestützte medizinische Intervention - config camitk-imp (4.1.2-4build1) [Universum] Workbench-Anwendung für die CamiTK-Bibliothek canu (1.9+dfsg-1build1) [Universum] Einzelmolekül-Sequenz-Assembler für Genome casacore-data-igrf (12-1) [Universum] Internationale geomagnetische Referenzfelddaten für casacore casacore-data-jpl-de200 (2007.07.05+ds.1-1) [Universum] Jet Propulsion Laboratory Development Ephemeride DE200 für casacore casacore-data-jpl-de405 (2007.07.05+ds.1-1) [Universum] Jet Propulsion Laboratory Development Ephemeride DE405 für casacore casacore-data-lines (0+git2016.11.26-2) [Universum] Tabelle der Spektrallinienfrequenzen für casacore casacore-data-observatories (0+git2018.12.08-2) [Universum] Tabelle der Radioobservatoriumskoordinaten für casacore casacore-data-sources (2-2) [Universum] Tabelle der ICRF-Referenzquellenkoordinaten für casacore casacore-data-tai-utc (1.2) [Universum] Differenztabelle zwischen TAI und UTC für casacore casacore-tools (3.2.1-4build3) [Universum] Werkzeuge gebaut mit CASA Cassbeam (1.1-2) [Universum] Cassegrain-Antennenmodellierung Cassiopee (1.0.9-2build1) [Universum] Index- und Suchwerkzeug in genomischen Sequenzen cba (0.3.6-5build1) [Universum] Kontinuierliche Strahlanalyse cbflib-bin (0.9.5.18+dfsg1-1build1) [Universum] Dienstprogramme zum Bearbeiten von CBF-Dateien cbmc (5.10-5ubuntu1) [Universum] Bounded Model Checker für C- und C++-Programme cclib (1.6.2-2) [Universum] Parser und Algorithmen für Computational Chemistry cclib-Daten (1.6.2-2) [Multiversum] Parser und Algorithmen für Computational Chemistry (Datendateien) cct (20170919+dfsg-1) [Universum] visueller Vergleich von Bakterien-, Plasmid-, Chloroplasten- oder Mitochondriensequenzen cct-Beispiele (20170919+dfsg-1) [Universum] Beispieldaten zum Testen des Pakets cct cd-hit (4.8.1-2build1) [Universum] Programmpaket zum schnellen Gruppieren von Sequenzen cdbfasta (0.99-20100722-6build1) [Universum] Konstante Datenbank-Indizierungs- und Abruftools für Zentrifuge mit mehreren FASTA-Dateien (1.0.3-3build1) [Universum] schnelles und speichereffizientes System zur Klassifizierung von DNA-Sequenzen cernlib (20061220+dfsg3-4.4build1) [Universum] CERNLIB-Datenanalyse-Suite - Metapaket für allgemeine Verwendung cernlib-core (20061220+dfsg3-4.4build1) [Universum] CERNLIB Datenanalyse-Suite - Hauptbibliotheken und Programme cernlib-core-dev (20061220+dfsg3-4.4build1) [Universum] CERNLIB-Datenanalysesuite - Kernentwicklungsdateien cernlib-extras (20061220+dfsg3-4.4build1) [Universum] CERNLIB Datenanalyse-Suite - Zusatzprogramme cernlib-montecarlo (20061220+dfsg3-3.1build4) [Universum] CERNLIB Monte Carlo Bibliotheken cg3 (1.3.1-2build3) [Universum] Tools zur Verwendung der 3. Auflage von Constraint Grammar (CG-3) cg3-dev (1.3.1-2build3) [Universum] Metapaket, das sowohl CG-3 CLI-Entwicklungstools als auch die Entwicklungsbibliothek cgns-convert (3.4.0-1) bereitstellt [Universum] CFD Allgemeines Notationssystem - Konvertierungswerkzeuge cgview (0.0.20100111-4) [Universum] Circular Genome Viewer changeo (0.4.6-1) [Universum] Toolkit für die klonale Repertoirezuweisung (Python 3) checkit-tiff (0.2.3-2) [Universum] Konformitätsprüfer für chemische Strukturen von Baseline-TIFFs (2.2.dfsg.0-15) [Universum] Satz molekularer Strukturen in offenen Formaten chemps2 (1.8.9-1build3) [Universum] Ausführbare Datei zum Aufrufen von libchemps2-3 über die Befehlszeile chemtool (1.6.14-5) [Universum] Programm zum Zeichnen chemischer Strukturen Chimeraslayer (20101212+dfsg1-3) [Universum] erkennt wahrscheinliche Chimären in PCR-amplifizierter DNA chromhmm (1.20+dfsg-1) [Universum] Chromatinzustandserkennung und Charakterisierung chromimpute (1.0.3+dfsg-1) [Universum] Groß angelegter systematischer Epigenom-Imputationszirkulator (1.5.6-1) [Universum] Genom-Assemblies zirkularisieren circos (0.69.9+dfsg-1) [Universum] Plotter zur Visualisierung von Daten circos-tools (0.23-1) [Universum] Plotter zur Visualisierung von Daten - Hilfsprogramme ckon (0.7.1-3build13) [Universum] automatisches Build-Tool für ROOT-Datenanalysesoftware clearcut (1.0.9-5) [Universum] extrem effiziente phylogenetische Baumrekonstruktion Klonalrahmen (1.2-10build1) [Universum] Inferenz der bakteriellen Mikroevolution unter Verwendung von Multilocus-Sequenzdaten klonalframeml (1.12-1) [Universum] Effiziente Inferenz der Rekombination in ganzen Bakteriengenomen Klonalorigin (1.0-3build1) [Universum] Rückschluss auf die homologe Rekombination in Bakterien unter Verwendung ganzer Genomsequenzen clustalo (1.2.4-4build1) [Universum] Mehrzweck-Multiple-Sequenz-Alignment-Programm für Proteine ​​clustalw (2.1+lgpl-6build1) [Universum] Globales multiples Nukleotid- oder Peptidsequenz-Alignment Clustalx (2.1+lgpl-8build1) [Multiversum] Mehrfaches Alignment von Nukleinsäure- und Proteinsequenzen (grafische Schnittstelle) Cluster3 (1,59+ds-1) [Multiversum] Neuimplementierung der Eisen-Clustering-Software cmor-tables (3.3-1) [Universum] MIP-Tabellen für die Climate Model Output Rewriter-Bibliothek cmtk (3.3.1p1+dfsg-2build1) [Universum] Computational Morphometry Toolkit cnvkit (0.9.6-3) [Universum] Erkennung von Kopienzahlvarianten von gezielten DNA-Sequenzierungs-Cod-Tools (2.10+dfsg-1) [Universum] Werkzeuge zum Bearbeiten von Dateien im CIF-Format code-saturne (6.0.2-1) [Universum] Allgemeine Computational Fluid Dynamics (CFD)-Software code-saturne-bin (6.0.2-1) [Universum] Allgemeine Computational Fluid Dynamics (CFD) Software - Binärcode-Saturne-Daten (6.0.2-1) [Universum] Allgemeine Software für Computational Fluid Dynamics (CFD) - Datencode-saturne-include (6.0.2-1) [Universum] Allzweck-Computational Fluid Dynamics (CFD)-Software - enthält codonw (1.4.4-4) [Universum] Korrespondenzanalyse der Codon-Nutzung coinor-cbc (2.10.3+repack1-1build1) [Universum] Coin-oder Branch-and-Cut Mixed-Integer-Programmierungslöser coinor-clp (1.17.5+repack1-1) [Universum] Coin- oder Linear-Programming-Solver coinor-csdp (6.2.0-1) [Universum] Ein Softwarepaket für semidefinite Programmierung coinor-libcbc3 (2.10.3+repack1-1build1) [Universum] Coin-oder Branch-and-Cut Mixed Integer Programming Solver (gemeinsam genutzte Bibliotheken) coinor-libcgl1 (0.60.3+repack1-2) [Universum] COIN-OR Cut Generation Library coinor-libclp1 (1.17.5+repack1-1) [Universum] Coin- oder Linear-Programming-Solver (gemeinsam genutzte Bibliotheken) coinor-libcoinutils3v5 (2.11.4+repack1-1) [Universum] Coin-oder Sammlung von Utility-Klassen (Binärdateien und Bibliotheken) coinor-libflopc++0v5 (1.0.6-3.1ubuntu3) [Universum] Formulierung linearer Optimierungsprobleme in C++ coinor-libosi1v5 (0.108.6+repack1-1) [Universum] COIN-OR Open Solver Interface coinor-libsymphony3 (5.6.16+repack1-2build1) [Universum] COIN-OR-Löser für gemischt-ganzzahlige lineare Programme (gemeinsam genutzte Bibliotheken) coinor-libvol1 (1.5.4-4) [Universum] Coin-oder Linear Programming Solver (Bibliotheken) Coinor-Symphony (5.6.16+repack1-2build1) [Universum] COIN-OR-Löser für gemischt-ganzzahlige lineare Programme colmap (3.6+dev2+git20191105-1build1) [Universum] Structure-from-Motion- und Multi-View-Stereokomet-ms (2018012-1build1) [Universum] Tandem-Massenspektrometrie (MS/MS)-Suchmaschinenkonkavität (0.1+dfsg.1-4build1) [Universum] Prädiktor für Protein-Liganden-Bindungsstellen aus Struktur und Konservierung Conda-Paket-Handling (1.6.0-2build1) [Universum] Erstellen und Extrahieren von Conda-Paketen verschiedener Formate connectome-workbench (1.4.2-1build1) [Universum] Gehirnvisualisierungs-, Analyse- und Entdeckungstool Konservierungscode (20110309.0-8) [Universum] Bewertungstool für die Erhaltung der Proteinsequenz cp2k (6.1-3ubuntu2) [Universum] Ab Initio Molecular Dynamics cp2k-Daten (6.1-3ubuntu2) [Universum] Ab Initio Molecular Dynamics (Datendateien) cpl-plugin-amber (4.3.9+dfsg-2) [Universum] ESO-Datenreduktionspipeline für das AMBER-Instrument cpl-plugin-amber-calib (4.3.9+dfsg-2) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für AMBER cpl-plugin-fors (5.4.3+dfsg-1build1) [Universum] ESO-Datenreduktionspipeline für die FORS1/2-Instrumente cpl-plugin-fors-calib (5.4.3+dfsg-1build1) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für FORS2 cpl-plugin-giraf (2.16.5+dfsg-1) [Universum] ESO-Datenreduktionspipeline für das GIRAFFE-Instrument cpl-plugin-giraf-calib (2.16.5+dfsg-1) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für GIRAFFE cpl-plugin-hawki (2.4.6+dfsg-1build1) [Universum] ESO-Datenreduktionspipeline für das HAWK-I-Instrument cpl-plugin-hawki-calib (2.4.6+dfsg-1build1) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für HAWK-I cpl-plugin-muse (2.8.1+dfsg-1) [Universum] ESO-Datenreduktionspipeline für das MUSE-Instrument cpl-plugin-muse-calib (2.8.1+dfsg-1) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für MUSE cpl-plugin-naco (4.4.8+dfsg-1) [Universum] ESO-Datenreduktionspipeline für das NaCo-Instrument cpl-plugin-naco-calib (4.4.8+dfsg-1) [Universum] ESO-Datenreduktionspipeline NaCo-Kalibrierungsdaten-Downloader cpl-plugin-uves (5.10.4+dfsg-1) [Universum] ESO-Datenreduktionspipeline für das UVES-Instrument cpl-plugin-uves-calib (5.10.4+dfsg-1) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für UVES cpl-plugin-vimos (3.3.0+dfsg-1build1) [Universum] ESO-Datenreduktionspipeline für das VIMOS-Instrument cpl-plugin-vimos-calib (3.3.0+dfsg-1build1) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für VIMOS cpl-plugin-visir (4.3.8+dfsg-1) [Universum] ESO-Datenreduktionspipeline für das VISIR-Instrument cpl-plugin-visir-calib (4.3.8+dfsg-1) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für VISIR cpl-plugin-xshoo (3.3.5+dfsg-2) [Universum] ESO-Datenreduktionspipeline für das XSHOOTER-Instrument cpl-plugin-xshoo-calib (3.3.5+dfsg-2) [Universum] ESO-Datenreduktions-Pipeline-Kalibrierungsdaten-Downloader für XSHOOTER cpuinfo (0.0

git20190201.d5e37ad-2) [Universum] CPU-Informationsbibliothek (binäre Dienstprogramme) crac (2.5.2+dfsg-2build2) [Universum] integrierte RNA-Seq-Read-Analyse-Critterding (1.0-beta12.1-1.3build1) [Universum] Evolving Artificial Life ctdconverter (2.1-1) [Universum] Konvertieren von CTD-Dateien in das Galaxy-Tool und CWL-CommandLineTool-Dateien ctsim (6.0.2-3build1) [Universum] Computertomographie-Simulator ctsim-help (6.0.2-3build1) [Universum] Online-Hilfedatei für CTSim-Manschettenknöpfe (2.2.1+dfsg.1-7) [Multiversum] Transkript-Assembly, differentielle Expression und Regulation für RNA-Seq cutadapt (2.8-2build1) [Universum] Saubere biologische Sequenzen aus Hochdurchsatz-Sequenzierung liest cwltool (2.0.20200224214940+dfsg-1) [Universum] Common Workflow Language Referenzimplementierungs-Daligner (1.0+git20200115.c2b47da-1) [Universum] Entdeckung des lokalen Alignments zwischen langen Nukleotid-Sequenzierungs-Reads Darknet (0.0.0+git20180914.61c9d02e-2build2) [Universum] Open Source Neuronale Netze in C dascrubber (1.1-1) [Universum] Alignment-basierte Scrubbing-Pipeline für die DNA-Sequenzierung liest datalad (0.12.4-2) [Universum] Datendateiverwaltungs- und Verteilungsplattform datalad-container (1.0.0-2) [Universum] DataLad-Erweiterung für die Arbeit mit containerisierten Umgebungen dawg (1.2-2build1) [Universum] simulieren die Evolution rekombinanter DNA-Sequenzen dazzdb (1.0+git20200115.d8adde7-2) [Universum] Nukleotidsequenzierung verwalten Daten lesen dcm2niix (1.0.20181125-1build1) [Universum] DICOM zu NIfTI Konverter der nächsten Generation dcmtk (3.6.4-2.1build2) [Universum] OFFIS DICOM-Toolkit-Befehlszeilen-Dienstprogramme debian-astro-logo (2.1) [Universum] Debian Astronomy Pure Blends Logo deepnano (0.0+git20170813.e8a621e-3.1) [Universum] alternativer Basecaller für MinION-Reads von genomischen Sequenzen deepnano-data (0.0+git20170813.e8a621e-3.1) [Universum] alternativer Basecaller für MinION-Reads von genomischen Sequenzen (Daten) delly (0.8.2-1) [Universum] Entdeckung von Strukturvarianten durch Leseanalyse dh-r (20200104) [Universum] Debian-Hilfstools zum Verpacken von R-Bibliotheken dialign (2.2.1-10) [Universum] Segmentbasiertes multiples Sequenz-Alignment dialign-tx (1.0.2-12) [Universum] Segmentbasiertes multiples Sequenz-Alignment dialign-tx-data (1.0.2-12) [Universum] Segmentbasiertes multiples Sequenz-Alignment (Datendateien) Diamond-Aligner (0.9.30-3) [Universum] beschleunigter BLAST-kompatibler lokaler Sequenz-Aligner dicomnifti (2.33.1-1build1) [Universum] konvertiert DICOM-Dateien in das NIfTI-Format dimbl (0.15-2.1build1) [Universum] Distributed Memory Based Learner dindel (1.01-wu1-3+dfsg-1build1) [Universum] bestimmt indel-Aufrufe von kurz gelesenen Daten disulfinder (1.2.11-8build1) [Universum] Cystein-Disulfid-Bindungszustand und Konnektivitätsprädiktor Disulfinder-Daten (1.2.11-8build1) [Universum] Datendateien für den Prädiktor von Disulfidbrücken in Proteinen dlmodelbox (1.1.1-1) [Universum] Schweizer Taschenmesser für Deep-Learning-Modelle dnaclust (3-7build1) [Universum] Tool zum Clustern von Millionen kurzer DNA-Sequenzen doris (5.0.3

beta+dfsg-13build1) [Multiversum] Delfter objektorientierter Radar-interferometrischer Software-Dotter (4.44.1+dfsg-3build1) [Universum] detaillierter Vergleich zweier genomischer Sequenzen dozzaqueux (3.51-2) [Universum] Simulator für chemische Gemische dozzaqueux-data (3.51-2) [Universum] Datenbanken für chemische Gemische dpuser (4.0+dfsg-2build1) [Universum] Interaktive Sprache zum Umgang mit Zahlen, Strings und Matrizen drawxtl (5.5-5build1) [Universum] Kristallstrukturbetrachter drslib (0.3.1.p3-2) [Universum] Befehlszeilentools für die Datenreferenzsyntaxbibliothek dsdp (5.8-9.4build1) [Universum] Software für semidefinite Programmierung dssp (3.0.0-3build1) [Universum] Protein-Sekundärstrukturzuordnung basierend auf 3D-Struktur dwgsim (0.1.12-3) [Universum] Short Sequencing Read Simulator dx (1:4.4.4-12build2) [Universum] OpenDX (IBM Visualization Data Explorer) - Hauptpaket dxf2gcode (20170925-4) [Universum] erstellt Teilezeichnungen für automatische Werkzeugmaschinen dxsamples (4.4.0-4) [Universum] Beispielprogramme für den OpenDX Data Explorer e-mem (1.0.1-2build1) [Universum] Effiziente Berechnung von Maximal Exact Matches für sehr große Genome e00compr (1.0.1-5) [Universum] Programm zum Lesen/Schreiben von Arcinfo komprimierten E00-Dateien ea-utils (1.1.2+dfsg-5build1) [Universum] Kommandozeilen-Tools zur Verarbeitung biologischer Sequenzierungsdaten easychem (0.6-8build1) [Universum] Zeichnen Sie hochwertige Moleküle und chemische 2D-Formeln ecaccess (4.0.1-1) [Universum] Clients für den Zugriff auf ECMWF-Einrichtungen ecflow-client (4.17.1-1build2) [Universum] Client-Tools für meteorologischen Workflow ecflow-server (4.17.1-1build2) [Universum] Meteorologischer Workflow-Controller - Server ecopcr (1.0.1+dfsg-1) [Universum] Schätzung der Qualität der PCR-Barcode-Primer edfbrowser (1.72+dfsg-1) [Universum] Viewer für Biosignal-Speicherdateien wie bdf und edf edlib-aligner (1.2.4-2ubuntu1) [Universum] Edlib-Sequenz-Alignment-Tool mit Edit Distance edtsurf (0.2009-6build1) [Universum] triangulierte Netzflächen für Proteinstrukturen eigensoft (7.2.1+dfsg-1build1) [Multiversum] Reduktion des Populationsbias für genetische Analysen elk-lapw (6.3.2-1) [Universum] Vollelektronendichte-funktionaler elektronischer Strukturcode elki (0.7.1-10.1) [Universum] Entwicklungsframework für Data-Mining-Algorithmen elki-dev (0.7.1-10.1) [Universum] Data-Mining-Algorithmus-Entwicklungsframework - Entwicklungsdateien elph (1.0.1-4build1) [Universum] DNA/Protein-Sequenz-Motiv-Finder Botschaft-Domainatrix (0.1.660-3) [Universum] Zusätzliche EMBOSS-Befehle zur Handhabung der Domänenklassifizierungsdatei embassy-domalign (0.1.660-3) [Universum] Zusätzliche EMBOSS-Befehle für Proteindomänen-Alignment embassy-domsearch (1:0.1.660-3) [Universum] Zusätzliche EMBOSS-Befehle zur Suche nach Proteindomänen embassy-phylip (3.69.660-3) [Multiversum] EMBOSS-Konvertierungen der Programme im phylip-Paket emboss (6.6.0+dfsg-7ubuntu2) [Universum] Europäische Open-Software-Suite für Molekularbiologie emboss-data (6.6.0+dfsg-7ubuntu2) [Universum] Datendateien für das EMBOSS-Paket emboss-explorer (2.2.0-10) [Universum] webbasierte GUI zu EMBOSS emmax (0

beta.20100307-1) [Universum] genetische Kartierung unter Berücksichtigung der Populationsstruktur engauge-digitalizer (10.10+ds.1-1build1) [Universum] extrahiert interaktiv Zahlen aus Bitmap-Graphen oder Karten ent (1.2debian-2) [Universum] Pseudozufallszahlenfolge-Testprogramm epigrass (2.5.0+dfsg-1build1) [Universum] wissenschaftliches Werkzeug für Simulationen und Szenarioanalysen in der Netzwerkepidemiologie epsilon-bin (0.9.2+dfsg-4) [Universum] Bibliothek für Wavelet-Bildkomprimierung - Tools ergo (3.8-1build1) [Universum] Quantenchemie-Programm für Großrechnungen Ergo-Daten (3.8-1build1) [Universum] Quantenchemieprogramm für Großrechnungen - Datenpaket eso-midas (19.02pl1.1-1build1) [Universum] Europäische Südsternwarte München Bilddatenanalysesystem eso-midas-testdata (19.02pl1.1-1build1) [Universum] Testdatendateien für ESO-MIDAS eso-Pipelines (1.3) [Universum] ESO VLT-Instrumenten-Pipeline-Sammlung esorex (3.13.2+dfsg-3build1) [Universum] Execution Tool für European Southern Observatory Pipelines estscan (3.0.3-3build1) [Universum] ORF-unabhängiger Detektor für kodierende DNA-Sequenzen esys-particle (2.3.5+dfsg1-4build2) [Universum] Software für partikelbasierte numerische Modellierung (MPI-Version) etsf-io (1.0.4-4build2) [Universum] Binäre Tools zum Überprüfen, Zusammenführen und Lesen von ETSF-Dateien, Beispiel (3.0.21-3) [Universum] Exascale Maximum Likelihood (ExaML) Code für phylogenetische Inferenz exonerate (2.4.0-4) [Universum] generisches Werkzeug für paarweisen Sequenzvergleich expeyes (4.6.2-1) [Universum] Hardware- und Software-Framework für die Entwicklung wissenschaftlicher Experimente expeyes-clib (4.6.2-1) [Universum] Hardware- und Software-Framework für die Entwicklung wissenschaftlicher Experimente eye (19.0928.2249

ds-1) [Universum] Semantic Web Reasoning Engine Eyes17 (4.6.2-1) [Universum] Hardware- und Software-Framework für die schnelle Entwicklung wissenschaftlicher Experimente5 (0.6.5-4build1) [Universum] Dienstprogramme zum Bearbeiten von Oxford Nanopore Fast5-Dateien fasta3 (36.3.8h-2) [Multiversum] Tools zum Durchsuchen von Sammlungen biologischer Sequenzen fasta3-doc (36.3.8h-2) [Multiversum] Benutzerhandbuch für FASTA-Tools fastahack (1.0.0+dfsg-5build1) [Universum] Dienstprogramm zur Indizierung und Sequenzextraktion aus FASTA-Dateien fastaq (3.17.0-2) [Universum] FASTA und FASTQ Dateibearbeitungstools fastdnaml (1.2.2-14) [Universum] Werkzeug zur Konstruktion phylogenetischer Bäume von DNA-Sequenzen fastlink (4.1P-fix100+dfsg-2) [Universum] schnellere Version der Stammbaumprogramme von Linkage fastlink-doc (4.1P-fix100+dfsg-2) [Universum] Einige Artikel über fastlink fastml (3.11-2build1) [Universum] Rekonstruktion der Aminosäuresequenz der Vorfahren mit maximaler Wahrscheinlichkeit fastp (0.20.0+dfsg-1build1) [Universum] Ultraschneller All-in-One-FASTQ-Präprozessor fastqc (0.11.9+dfsg-2) [Universum] Qualitätskontrolle für Sequenzdaten mit hohem Durchsatz fastqtl (2.184+dfsg-7build2) [Universum] Quantitative Trait Loci (QTL) Mapper in cis für molekulare Phänotypen fasttree (2.1.11-1) [Universum] phylogenetische Bäume aus Alignments von Nukleotid- oder Proteinsequenzen fcc (2.8-1build3) [Universum] Skript zum Kompilieren von C/C++-Programmen und zum Verknüpfen mit Fortran-Bibliotheken feedgnuplot (1.53-1) [Universum] Pipe-orientiertes Frontend zu Gnuplot ffindex (0.9.9.9-3) [Universum] einfacher Index/Datenbank für große Mengen kleiner Dateien figtree (1.4.4-4) [Universum] grafischer phylogenetischer Baumbetrachter fitgcp (0.0.20150429-3) [Universum] Anpassung der Genomabdeckungsverteilungen mit Mischungsmodellen Fitscut (1.4.4-5) [Universum] Ausschnitte aus FITS-Bildformatdateien extrahieren fish (0.9.2-1) [Universum] Softwarepaket für astronomische Bildverarbeitung fitpng (1.4-1build1) [Universum] FITS to PNG Konverter fitverify (4.20-1build1) [Universum] FITS Dateiformat-Verifizierungstool fityk (1.3.1-5build1) [Universum] Flexbar (1:3.5.0-2build1) für allgemeine nichtlineare Kurvenanpassung und Datenanalyse [Universum] flexible Barcode- und Adapterentfernung für Sequenzierungsplattformen flextra (5.0-13build1) [Universum] Trajektorienmodell zur Verfolgung von Lufttransportphänomenen fml-asm (0.1-9ubuntu1) [Universum] Werkzeug zum Zusammensetzen von Illumina-Short-Reads in kleinen Regionen foma (1:0.9.18+r243-6) [Universum] Werkzeuge zum Konstruieren verschiedener endlicher Automaten foma-bin (1:0.9.18+r243-6) [Universum] Übergangspaket für Formular foma (4.2.1+git20200217-1) [Universum] Symbolisches Manipulationssystem Fractalnow (0.8.2-4build1) [Universum] Schneller, fortschrittlicher Fraktalgenerator free42-nologo (1.4.77-1.2build1) [Universum] Free42 ist eine Neuimplementierung des HP-42S-Rechners freebayes (1.3.2-2) [Universum] Bayes-Haplotyp-basierte Polymorphismus-Entdeckung und Genotypisierung freecad (0.18.4+dfsg2-1ubuntu4) [Universum] Erweiterbares Open Source CAx-Programm freecad-common (0.18.4+dfsg2-1ubuntu4) [Universum] Erweiterbares Open Source CAx-Programm - allgemeine Dateien freecad-python3 (0.18.4+dfsg2-1ubuntu4) [Universum] Erweiterbares Open Source CAx-Programm - Python 3 Binaries freecad-runtime (0.18.4+dfsg2-1ubuntu4) [Universum] Erweiterbares Open Source CAx-Programm - Laufzeitdateien freecontact (1.0.21-7build1) [Universum] schneller Proteinkontakt-Prädiktorfrosch (0.15-1build2) [Universum] Tagger und Parser für natürliche Sprachen (Laufzeit) frogdata (0.16-1) [Universum] Datendateien für Frog fsa (1.15.9+dfsg-4build1) [Universum] Schneller statistischer Abgleich von Protein-, RNA- oder DNA-Sequenzen fsl-5.0-core (5.0.8-6ubuntu2) [Multiversum] Analysetools für FMRI, MRT und DTI Bildgebung des Gehirns fsl-core (5.0.8-6ubuntu2) [Multiversum] Metapaket für die neueste Version von FSL fsm-lite (1.0-3build1) [Universum] frequenzbasiertes String-Mining (lite) ftools-fv (5.5+dfsg-2build2) [Universum] Tool zum Anzeigen und Bearbeiten von Dateien im FITS-Format ftools-pow (5.5+dfsg-2build2) [Universum] Interface-Tool für Kurvendarstellung und Bildanzeige funtools (1.4.7-4) [Universum] Minimaler Buy-in FITS Utility-Paket fxt-tools (0.3.9-3) [Universum] Multithread-Tracing-Bibliothek g3data (1:1.5.3-2.1build1) [Universum] Daten aus gescannten Grafiken extrahieren gabedit (2.5.0-1) [Universum] grafische Benutzeroberfläche für Ab Initio-Pakete galileo (0.5.1-6) [Universum] Dienstprogramm zum sicheren Synchronisieren eines Fitbit-Geräts mit dem Fitbit-Webdienst galileo-daemon (0.5.1-6) [Universum] Dienstprogramm zum sicheren Synchronisieren eines Fitbit-Geräts - Daemon gamgi (0.17.3-2) [Universum] General Atomistic Modeling Graphic Interface (GAMGI) gamgi-data (0.17.3-2) [Universum] General Atomistic Modeling Graphic Interface (Daten) garli (2.1-3build1) [Universum] phylogenetische Analyse molekularer Sequenzdaten anhand von Maximum-Likelihood-Garli-Beispielen (2.1-3build1) [Universum] phylogenetische Analyse molekularer Sequenzdaten (Beispiele) garli-mpi (2.1-3build1) [Universum] phylogenetische Analyse von molekularen Sequenzdaten mit Maximum-Likelihood (MPI) Knoblauch (1,6-3) [Universum] Visualisierungsprogramm für Biomoleküle gasisch (0.0.r19-5) [Universum] Genom-Abundanz-Ähnlichkeitskorrektur gatb-core (1.4.1+git20191209.9398f28+dfsg-2) [Universum] Genomanalyse-Toolbox mit de-Bruijn-Grafik gatb-core-testdata (1.4.1+git20191209.9398f28+dfsg-2) [Universum] Genome Analysis Toolbox mit de-Bruijn-Graph (Testdaten) Gausssum (3.0.2-2) [Universum] Gaussian-, GAMESS- usw. ausgeben und anzeigen Gazebo9 (9.12.0+dfsg-1build2) [Universum] Open-Source-Robotik-Simulator - Binärdateien Gazebo9-Common (9.12.0+dfsg-1build2) [Universum] Open-Source-Robotik-Simulator - Freigegebene Dateiengazebo9-plugin-base (9.12.0+dfsg-1build2) [Universum] Open Source Robotics Simulator - Basis-Plug-Ins gbrowse (2.56+dfsg-8) [Universum] GMOD Generic Genome Browser gbrowse-calign (2.56+dfsg-8) [Universum] CAalign-Helfer gbrowse-data (2.56+dfsg-8) [Universum] Beispieldaten zur Verwendung von GBrowse gbutils (5.7.1-1) [Universum] Dienstprogramme für die Befehlszeilenökonometrie gchempaint (0.14.17-3) [Universum] 2D-Editor für chemische Strukturen für den GNOME2-Desktop gcrystal (0.14.17-3) [Universum] Leichte Kristallstrukturen Visualisierer gcu-bin (0.14.17-3) [Universum] GNOME-Chemie-Hilfsprogramme (Hilfsanwendungen) gcx (1.3-1.1build1) [Universum] astronomische Bildverarbeitung und Photometrie gtk+ Anwendung gdal-bin (3.0.4+dfsg-1build3) [Universum] Geospatial Data Abstraction Library - Dienstprogramme gdal-data (3.0.4+dfsg-1build3) [Universum] Geospatial Data Abstraction Library - Datendateien gdis (0.90-5build1) [Universum] Molekular- und Kristallmodellbetrachter gdis-data (0.90-5build1) [Universum] Molekular- und Kristallmodell-Viewer (Datendateien) gdl-mpfit (1.85+2017.01.03-4) [Universum] Robuste nichtlineare Kurvenanpassung nach der Methode der kleinsten Quadrate für GDL gdpc (2.2.5-10) [Universum] Visualisierer molekulardynamischer Simulationen gdpc-Beispiele (2.2.5-10) [Universum] Beispieldateien für das gdpc-Programm geant321 (1:3.21.14.dfsg-11build4) [Universum] [Physik] Partikeldetektor-Beschreibungs- und Simulationstool geant321-data (1:3.21.14.dfsg-11build4) [Universum] [Physik] Daten für GEANT 3.21 Detektorsimulator gelemental (2.0.0-1build1) [Universum] Periodensystem-Viewer Gemma (0.98.1+dfsg-1) [Universum] Genomweite Efficient Mixed Model Association gemma-doc (0.98.1+dfsg-1) [Universum] Beispielordner für GEMMA Genometester (4.0+git20180508.a9c14a6+dfsg-1) [Universum] Toolkit zum Ausführen von Mengenoperationen auf k-mer-Listen Genomethreader (1.7.3+dfsg-5) [Universum] Softwaretool zur Berechnung von Genstrukturvorhersagen Genometools (1.6.1+ds-2) [Universum] vielseitiges Genomanalyse-Toolkit Genometools-Common (1.6.1+ds-2) [Universum] freigegebene Datendateien für GenomeTools sanft (1.9+cvs20100605+dfsg1-8build1) [Multiversum] Suite zum Planen des genetischen Klonens geographiclib-tools (1.50.1-1build1) [Universum] C++-Bibliothek zur Lösung einiger geodätischer Probleme -- tools geotiff-bin (1.5.1-2) [Universum] GeoTIFF-Bibliothek (geografisch aktiviertes TIFF) -- Werkzeuge getdata (0.2-3) [Universum] Verwaltung externer Datenbanken gff2aplot (2.0-11) [Universum] paarweise Alignment-Plots für genomische Sequenzen in PostScript gff2ps (0.98l-2) [Universum] erzeugt eine grafische PostScript-Ausgabe aus GFF-Dateien gffread (0.11.7-2) [Universum] GFF/GTF-Formatkonvertierungen, Regionsfilterung, FASTA-Sequenzextraktion gfsview (20121130+dfsg-6) [Universum] grafischer Viewer für Gerris-Simulationsdateien gfsview-batch (20121130+dfsg-6) [Universum] Batch-Version des Viewers für Gerris-Simulationsdateien ghkl (5.0.0.2569-1build1) [Universum] Diffraktometer-Berechnungssteuerungsanwendung ghmm (0,9

rc3-2ubuntu2) [Universum] Allgemeine Hidden-Markov-Modellbibliothek - Tools giella-core (0.1.1

r129227+svn121148-2ubuntu1) [Universum] GTCORE-Dateien zum Erstellen von Giellatekno-Sprachpaketen giella-sme (0.0.20150917

r121176-3) [Universum] Giellatekno einsprachige Daten für Nord-Saami giella-sme-dev (0.0.20150917

r121176-3) [Universum] Giellatekno einsprachige Daten für Nord-Saami (Entwicklungs-Extras) ginga (3.0.0-1) [Universum] Astronomischer Bildbetrachter ginkgocadx (3.8.8-3build1) [Universum] Medizinische Bildgebungssoftware und kompletter DICOM Viewer glam2 (1064-8) [Universum] mit Lücken versehene Proteinmotive aus nicht ausgerichteten Sequenzen glueviz (0.15.5+dfsg-1) [Universum] Verknüpfte Datenvisualisierung gmap (2020-04-08+ds1-1) [Universum] gespleißtes und SNP-tolerantes Alignment für mRNA und kurze Reads gmt (6.0.0+dfsg-1build2) [Universum] Generische Mapping-Tools gmt-common (6.0.0+dfsg-1build2) [Universum] Generic Mapping Tools - Architekturunabhängige Dateien gmt-dcw (1.1.4-2) [Universum] Digitale Karte der Welt (DCW) für GMT gmt-gshhg (2.3.7-4) [Universum] Globale selbstkonsistente hierarchische hochauflösende Geographie (GSHHG) gmt-gshhg-full (2.3.7-4) [Universum] Küstenlinien in voller Auflösung für die Generic Mapping Tools gmt-gshhg-high (2.3.7-4) [Universum] Hochauflösende Küstenlinien für die Generic Mapping Tools gmt-gshhg-low (2.3.7-4) [Universum] Küstenlinien mit niedriger Auflösung für die Generic Mapping Tools gnuastro (0.11-1build1) [Universum] GNU Astronomy Utilities Programme gpaw (20.1.0-2build1) [Universum] DFT und darüber hinaus innerhalb der Projektor-Augmented-Wave-Methode gpaw-data (0.9.20000-2) [Universum] gpaw-Datensätze/Setups gperiodisch (3.0.3-1) [Universum] Periodensystemanwendung gpx (2.5.2-4) [Universum] Gcode zu x3g Konvertierung Postprozessor gr-fcdproplus (3.8

20190817-3build3) [Universum] Funcube Dongle Pro Plus Controller für GNU Radio grabix (0.1.7-2build1) [Universum] wee-Tool für wahlfreien Zugriff auf BGZF-Dateien grads (3:2.2.1-2build3) [Universum] Gitteranalyse- und Anzeigesystem für geowissenschaftliche Datengraphlan (1.1.3-2) [Universum] kreisförmige Darstellungen von taxonomischen und phylogenetischen Grasbäumen (7.8.2-1build3) [Universum] Geographic Resources Analysis Support System (GRASS GIS) grass-core (7.8.2-1build3) [Universum] GRASS GIS Kernkomponenten grass-doc (7.8.2-1build3) [Universum] GRASS GIS Benutzerdokumentation grass-gui (7.8.2-1build3) [Universum] GRASS GIS grafische Benutzeroberflächen gravit (0.5.1+dfsg-3) [Universum] visuell beeindruckender Gravitationssimulator Gravitationsdaten (0.5.1+dfsg-3) [Universum] Datendateien für Gravit-Schleifer (0.5.4-5) [Universum] Vielseitige Omics-Schrotflinte und Amplikon-Sequenzierung lesen Simulator Gromacs (2020.1-1) [Universum] Molekulardynamiksimulator, mit Bau- und Analysetools gromacs-data (2020.1-1) [Universum] GROMACS Molekulardynamiksimulation, Daten und Dokumentation gromacs-mpich (2020.1-1) [Universum] Molecular Dynamics sim, Binaries for MPICH Parallelization gromacs-openmpi (2020.1-1) [Universum] Molekulardynamiksimulation, Binärdateien für OpenMPI-Parallelisierungs-Gubbins (2.3.5-1) [Universum] phylogenetische Analyse von Genomsequenzen gvb (1.4-1.1) [Universum] visueller Simulator von 1- und 2-dimensionalen Schwingungen gwama (2.2.2+dfsg-2build1) [Universum] Genomweite Assoziations-Metaanalyse gwyddion (2.55-3) [Universum] Rastersondenmikroskopie-Visualisierungs- und Analysetool gwyddion-common (2.55-3) [Universum] architekturunabhängige Dateien für das Gwyddion SPM-Analysetool gyoto (1.4.4-3) [Universum] Allgemeine relativistische geodätische Integration und Ray-Tracing Gyoto-Bin (1.4.4-3) [Universum] Allgemeine relativistische Raytracing-Befehlszeilenschnittstelle h5utils (1.13.1-3build1) [Universum] Visualisierungstools für HDF5-Dateien harminv (1.4.1-2build1) [Universum] Extraktion komplexer Frequenzen und Amplituden aus Zeitreihen-Ernte-Tools (1.3-4build2) [Universum] Archivierung und Nachbearbeitung für referenzkomprimierte genomische Multi-Alignments hdf-Kompass (0,7

b8-2) [Universum] Viewer für HDF5 und verwandte Formate hdf5-helpers (1.10.4+repack-11ubuntu1) [Universum] Hierarchisches Datenformat 5 (HDF5) - Hilfswerkzeuge hdf5-tools (1.10.4+repack-11ubuntu1) [Universum] Hierarchisches Datenformat 5 (HDF5) - Laufzeittools herisvm (0.8.2-1) [Universum] Machine-Learning-Tools für Klassifikationsalgorithmen hfst (3.15.1-2build3) [Universum] Helsinki Finite-State Transducer Technology hfst-ospell (0.5.0-2build2) Rechtschreibprüfungsbibliothek und Werkzeug basierend auf HFST hhsuite (3.2.0-2build1) [Universum] sensitive Proteinsequenzsuche basierend auf HMM-HMM Alignment hhsuite-Daten (3.2.0-2build1) [Universum] Sensible Proteinsequenzsuche basierend auf HMM-HMM-Alignment (Daten) hilive (2.0a-3build2) [Universum] Echtzeit-Ausrichtung von Illumina liest Scharnier (0.5.0-6) [Universum] Long-Read-Genom-Assembler basierend auf Hinging hisat2 (2.1.0-4) [Universum] Graphbasiertes Alignment kurzer Nukleotid-Reads zu vielen Genomen hmmer (3.3+dfsg2-1) [Universum] Profil Hidden-Markov-Modelle für die Proteinsequenzanalyse hmmer2 (2.3.2+dfsg-6) [Universum] Profil Hidden-Markov-Modelle für die Proteinsequenzanalyse hmmer2-pvm (2.3.2+dfsg-6) [Universum] HMMER-Programme mit PVM (Parallel Virtual Machine) unterstützen hodie (1.5.0-1) [Universum] gibt das Datum in lateinischer Sprache aus hpcc (1.5.0-2) [Universum] HPC Challenge-Benchmark htcondor (8.6.8

dfsg.1-2ubuntu1) [Universum] verteiltes Workload-Management-System hyphy-common (2.5.1+dfsg-3) [Universum] Hypothesentestung mit Phylogenien (gemeinsame Dateien) hyphy-mpi (2.5.1+dfsg-3) [Universum] Hypothesentestung mit Phylogenies (MPI-Version) hyphy-pt (2.5.1+dfsg-3) [Universum] Hypothesentest mit Phylogenies (pthreads-Version) idba (1.1.3-5build1) [Universum] iterative De Bruijn Graph Short-Read-Assembler igdiscover (0.11-3) [Universum] analysiert Antikörperrepertoires, um neue V-Gene zu finden igor (1.3.0+dfsg-1build1) [Universum] leitet V(D)J-Rekombinationsprozesse aus Sequenzierungsdaten ab igv (2.4.17+dfsg-1) [Multiversum] Integrative Genomics Viewer imagej (1.52r-1) [Universum] Bildverarbeitungsprogramm mit Fokus auf Mikroskopiebilder imview (1.1.9h-1build1) [Universum] Bildbetrachtungs- und Analyseanwendung unauslöschbar (1.03-4build1) [Universum] leistungsfähiger und flexibler Simulator der biologischen Evolution indigo-utils (1.2.3-3build1) [Universum] Organische Chemie Toolkit Utilities infernal (1.1.3-4) [Universum] Inferenz von RNA-Sekundärstruktur-Alignments inhomog (0.1.9.2-1) [Universum] kinematische Rückreaktion und durchschnittliche Skalierungsfaktorentwicklung inkscape-speleo (1.8-4) [Universum] Inkscape-Plugin zum Zeichnen von Umfragen inkscape-survex-export (1.0-3) [Universum] Inkscape-Plugin zum Digitalisieren gedruckter Umfragen ipig (0.0.r5-3) [Universum] Integration von PSMs in Genombrowser-Visualisierungen iqtree (1.6.12+dfsg-1build1) [Universum] effiziente phylogenetische Software nach Maximum Likelihood iraf (2.16.1+2018.11.01-3) [Universum] Image Reduction and Analysis Facility iraf-dev (2.16.1+2018.11.01-3) [Universum] Image Reduction and Analysis Facility (Entwicklungsdateien) iraf-fitsutil (2018.07.06-4) [Universum] FITS-Dienstprogramme für IRAF iraf-mscred (5.05+2018.07.09-1build2) [Universum] CCD-Mosaik-Reduktionspaket für IRAF iraf-noao (2.16.1+2018.11.01-3) [Universum] IRAF NOAO-Datenreduktionspaket iraf-noao-dev (2.16.1+2018.11.01-3) [Universum] IRAF NOAO-Datenreduktionspaket (Entwicklungsdateien) iraf-rvsao (2.8.3-1build2) [Universum] IRAF-Paket zur Ermittlung von Radialgeschwindigkeiten aus Spektren iraf-sptable (1.0

vor20180612-1build2) [Universum] IRAF-Paket für Tabular Spectra iraf-wcstools (3.9.5-3) [Universum] Behandeln des WCS eines FITS-Images (IRAF-Paket) ismrmrd-schema (1.4.0-1build1) [Universum] Schema für ISMRMRD ismrmrd-tools (1.4.0-1build1) [Universum] Befehlszeilentools für ISMRMRD itksnap (3.6.0-5build1) [Universum] halbautomatische Segmentierung von Strukturen in 3D-Bildern iva (1.0.9+ds-10) [Universum] iterativer Virussequenz-Assembler-Jaligner (1.0+dfsg-6) [Universum] Smith-Waterman-Algorithmus mit Gotohs Verbesserung jblas (1.2.4-2build1) [Universum] schnelle lineare Algebra-Bibliothek für Java Quallen (2.3.0-4build1) [Universum] k-mere in DNA-Sequenzen zählen Quallen-Beispiele (2.3.0-4build1) [Universum] k-mere in DNA-Sequenzen zählen (Beispiele zum Testen) Qualle1 (1.1.11-4build1) [Universum] k-mere in DNA-Sequenzen zählen jemboss (6.6.0+dfsg-7ubuntu2) [Universum] grafische Benutzeroberfläche zu EMBOSS jmodeltest (2.1.10+dfsg-8) [Universum] HPC-Auswahl von Modellen der Nukleotidsubstitution jmol (14.6.4+2016.11.05+dfsg1-4build1) [Universum] Molekularer Viewer jsamp (1.3.7-1) [Universum] Java Simple Application Messaging Protocol-Tool für VO Jube (2.2.2-1) [Universum] JUBE Benchmarking-Umgebung julia (1.4.1+dfsg-1) [Universum] Hochleistungs-Programmiersprache für Technical Computing julia-common (1.4.1+dfsg-1) [Universum] Hochleistungs-Programmiersprache für Technical Computing (gemeinsame Dateien) jupyter-notebook (6.0.3-2) [Universum] Jupyter interaktives Notizbuch kalign (1:2.03+20110620-5) [Universum] Globales und progressives Multiple Sequence Alignment kallisto (0.46.1+dfsg-2build1) [Universum] nahezu optimale RNA-Seq-Quantifizierung Kallisto-Beispiele (0.46.1+dfsg-2build1) [Universum] nahezu optimale RNA-Seq-Quantifizierung (Beispieldaten) Kalzium (4:19.12.3-0ubuntu1) [Universum] Periodensystem und Chemietools Kalzium-Daten (4:19.12.3-0ubuntu1) [Universum] Datendateien für Kalzium kaptive (0.7.0-2) [Universum] Informationen über K- und O-Typen für Klebsiella-Genom-Assemblies erhalten kaptive-data (0.7.0-2) [Universum] Referenzdaten für kaptive für Klebsiella-Genom-Assemblies kaptive-Beispiel (0.7.0-2) [Universum] Beispieldaten für kaptive für Klebsiella Genomassemblys khmer-common (2.1.2+dfsg-6build2) [Universum] gemeinsame Dateien für die khmer-Projekttools king-probe (2.16.160404+git20180613.a09b012-1) [Universum] Bewerten und visualisieren Sie die interatomare Proteinpackung Kissplice (2.4.0-p1-5ubuntu1) [Universum] Nachweis verschiedener Arten von Polymorphismen in RNA-Seq-Daten Kleborat (1.0.0-3) [Universum] Tool zum Screenen von Klebsiella Genom-Assemblies Kleborat-Beispiele (1.0.0-3) [Universum] Tool zum Screenen von Klebsiella-Genom-Assemblies (Beispieldaten) klustakwik (2.0.1-1build2) [Universum] automatische Sortierung der Proben (Spikes) in Cluster kma (1.2.21-1) [Universum] Zuordnung genomischer Sequenzen zu Raw-Reads direkt gegen redundante Datenbanken kmc (2.3+dfsg-7build1) [Universum] kmer in genomischen Sequenzen zählen kmerresistance (2.2.0-1) [Universum] korreliert kartierte Gene mit den vorhergesagten Arten von WGS-Proben konkludieren (0.6.2+939

dfsg-1build1) [Universum] Tableau-basierter Beschreibungslogik-Begründer für das Semantic Web Kraken (1.1.1-1build1) [Universum] Zuordnung taxonomischer Markierungen zu kurzen DNA-Sequenzen kraken2 (2.0.8

Beta-1-Build1) [Universum] taxonomisches Klassifikationssystem mit exakten k-mer-Übereinstimmungen kst (2.0.8-3build4) [Universum] Werkzeug zum Plotten von wissenschaftlichen Daten kstars (5:3.4.1-1) [Universum] Desktop Planetarium, Beobachtungsplanung und Teleskopsteuerung kstars-data (5:3.4.1-1) [Universum] Datendateien für KStars Desktop-Planetarium kstars-data-extra-tycho2 (1.1r1-9.1) [Universum] Tycho-2 Sternenkatalog für KStars kxterm (20061220+dfsg3-4.4build1) [Universum] CERNLIB-Datenanalysesuite - KUIP-Terminalemulator lagan (2.0-5build1) [Universum] hochparametrisierbarer paarweise globaler Genomsequenz-Aligner Lamarc (2.1.10.1+dfsg-4build1) [Universum] Likelihood-Analyse mit Metropolis-Algorithmus unter Verwendung von Random Coalescence lambda-align (1.0.3-6) [Universum] Lokaler Aligner für massive biologische Daten Lambda-align2 (2.0.0-2build1) [Universum] Local Aligner für massive biologische Daten - v2 Lampen (20191120+dfsg1-2build2) [Universum] Molekulardynamik-Simulator letzte Ausrichtung (1060-1) [Universum] Vergleich biologischer Sequenzen auf Genomskala lefse (1.0.8-3) [Universum] bestimmen Merkmale von Organismen, Kladen, taxonomische Einheiten, Gene libadios-bin (1.13.1-20) [Universum] ADIOS Adaptierbares IO-System für Simulationen - Binaries libadios-examples (1.13.1-20) [Universum] Beispiele für die ADIOS Adaptable IO System Libarb (6.0.6-4build1) [Multiversum] phylogenetische Sequenzanalyse-Suite - Bibliotheken libatlas-ecmwf-utils (0.19.0-8build1) [Universum] Numerische Wettervorhersage- und Klimamodellierungsbibliothek - Dienstprogramme libball1.5-data (1.5.0+git20180813.37fc53c-4build2) [Universum] Bibliothek biochemischer Algorithmen (Datendateien) libbio-db-hts-perl (3.01-3) [Universum] Perl-Schnittstelle zur HTS-Bibliothek libbio-tools-phylo-paml-perl (1.7.3-2) [Universum] Bioperl-Schnittstelle zur PAML-Suite libbio-tools-run-alignment-clustalw-perl (1.7.4-1) [Universum] Bioperl-Schnittstelle zu Clustal W libbio-tools-run-alignment-tcoffee-perl (1.7.4-1) [Universum] Bioperl-Schnittstelle zu T-Coffee libbiojava-java (1:1.7.1-8) [Universum] Java API für biologische Daten und Anwendungen (Standardversion) libbiojava-java-demos (1:1.7.1-8) [Universum] Beispielprogramme für BioJava libbiojava1.7-java (1:1.7.1-8) [Universum] Java API für biologische Daten und Anwendungen (Version 1.7) libcamitk4 (4.1.2-4build1) [Universum] Toolkit für computergestützte medizinische Intervention - Laufzeit libcassie1v5 (1.0.9-2build1) [Universum] Bibliothek, die Suchalgorithmen implementiert libcg3-1 (1.3.1-2build3) [Universum] Laufzeit für CG-3 libclhep2.1v5 (2.1.4.1+dfsg-1build1) [Universum] CLHEP: Eine Klassenbibliothek für Hochenergiephysik libdivsufsort3 (2.0.1-4) [Universum] schnelle Suffix-Array-Konstruktion libeccodes-data (2.16.0-1) [Universum] GRIB- und BUFR-Encoding/Encoding-Softwarebibliothek - data libeckit-utils (1.4.7-7build1) [Universum] C++-Toolkit für ECMWF-Tools und -Anwendungen - Entwicklungsdateien libej0 (4.6.2-1) [Universum] Hardware- und Software-Framework für die Entwicklung wissenschaftlicher Experimente libgenometools0 (1.6.1+ds-2) [Universum] vielseitige Genomanalysebibliothek libgfsgl0 (20121130+dfsg-6) [Universum] grafischer Viewer für Gerris-Simulationsdateien. Gemeinsam genutzte Bibliothek libghemical-data (3.0.0-4.2build3) [Universum] Molecular Modeling Library (Datendateien) libgiac0 (1.5.0.85+dfsg1-3) [Universum] Computer Algebra System C++ Bibliothek libgtkdatabox0-glade (1:0.9.3.1-1) [Universum] Gtk+ Bibliothek zur Anzeige großer Mengen numerischer Daten (glade API) libgtkdatabox0-libglade (1:0.9.3.1-1) [Universum] Gtk+-Bibliothek zum Anzeigen großer Mengen numerischer Daten (glade lib) libhdf5-jni (1.10.4+repack-11ubuntu1) [Universum] native Bibliothek, die von libhdf5-java verwendet wird libismrmrd1.3 (1.4.0-1build1) [Universum] ISMRM-Rohdatenformat (ISMRMRD) liblammps-dev (20191120+dfsg1-2build2) [Universum] Molekulardynamik-Simulator (Entwicklungsdateien) liblammps0 (20191120+dfsg1-2build2) [Universum] Molecular Dynamics Simulator (gemeinsam genutzte Bibliothek) libliggghts3 (3.8.0+repack1-5build1) [Universum] Open-Source-DEM-Partikelsimulationssoftware. Gemeinsam genutzte Bibliothek liblinear-tools (2.3.0+dfsg-3build1) [Universum] Eigenständige Anwendungen für LIBLINEAR liblorene-debian1 (0.0.0

cvs20161116+dfsg-1ubuntu6) [Universum] liblorene gemeinsam genutzte Bibliothek liblorene-export-debian0 (0.0.0

cvs20161116+dfsg-1ubuntu6) [Universum] liblorene_export gemeinsam genutzte Bibliothek liblorenef77-debian1 (0.0.0

cvs20161116+dfsg-1ubuntu6) [Universum] liblorenef77 gemeinsam genutzte Bibliothek libmstoolkit-tools (82-6build1) [Universum] Bibliotheken zur Manipulation von Massenspektrometriedaten - Tools libncarg-bin (6.6.2-1build4) [Universum] NCAR-Befehlssprachenbibliothek - Entwicklungstools libncarg-data (6.6.2-1build4) [Universum] NCAR-Befehlssprachenbibliothek - Data libngram-tools (1.3.2-3build1) [Universum] OpenGRM n-gram Language Modeling Toolkit libocas-tools (0.97+dfsg-6) [Universum] Eigenständige Anwendungen, die den OCAS-Solver libopenfoam (1906.191111+dfsg1-2build1) implementieren [Universum] Open-Source-Toolbox für Computational Fluid Dynamics (CFD) - Bibliotheken libotb (7.0.0+dfsg-2build3) [Universum] ORFEO Toolbox Bibliotheks-Metapaket libotb-apps (7.0.0+dfsg-2build3) [Universum] Plugins für ORFEO Toolbox-Anwendungen libpluto-jpl-eph-dev (0.0

git20180228-1.1build1) [Universum] Entwicklungsdateien zur Interaktion mit JPL-Ephemeren-Daten libpluto-lunar-dev (0.0

git20180825.e34c1d1-1build1) [Universum] Entwicklungsdateien für die astronomische Lunar-Bibliothek libpwiz-tools (3.0.18342-2) [Universum] ProteoWizard-Befehlszeilentools libqgis-customwidgets (3.10.4+dfsg-1ubuntu2) [Universum] QGIS benutzerdefinierte Widgets für Qt Designer libqtpropertybrowser4 (4.1.2-4build1) [Universum] Qt Property Browser Library - Laufzeit libasterlite2-1 (1.1.0

rc0+devel1-2build1) [Universum] Bibliothek für große Raster-Coverages mit einem SpatiaLite DBMS librsl1 (1.43-1.2build1) [Universum] TRMM Radar-Softwarebibliothek libsilo-bin (4.10.2.real-7) [Universum] Dienstprogramme zum Bearbeiten von libsilo-Dateien libsqlite3-mod-virtualpg (2.0.0

rc0-1) [Universum] Ladbare dynamische Erweiterung für SQLite und SpatiaLite libsquizz (0.99d+dfsg-2) [Universum] Konvertierungsbibliotheken, die von squizz Gensequenzkonverter libssm-bin (1.4.0-1build1) verwendet werden [Universum] Makromolekulare Superpositionsbibliothek - Binärdateien libstxxl1v5 (1.4.1-3build1) [Universum] C++ Standard Template Library für extra große Datensätze libvcflib-tools (1.0.1+dfsg-3) [Universum] C++-Bibliothek zum Parsen und Manipulieren von VCF-Dateien (Tools) libvdjtools-java (1.2.1+git20190311-1) [Multiversum] Java-Bibliothek von vdjtools libxy-bin (1.3-1.1build2) [Universum] xylib - Dienstprogramme libyade (2020.01a-6build2) [Universum] Plattform für die Modellierung diskreter Elemente. Bibliotheksbeleuchtung (3.8.0+repack1-5build1) [Universum] Open-Source-DEM-Partikelsimulationssoftware. litl-tools (0.1.9-7) [Universum] Lightweight Trace Library - Tools logol (1.7.9-2) [Universum] Mustervergleichstool mit Logol-Sprache logol-bin (1.7.9-2) [Universum] Mustervergleichswerkzeug mit Logol-Sprachloki (2.4.7.4-10) [Universum] MCMC-Verknüpfungsanalyse an allgemeinen Stammbäumen loki-doc (2.4.7.4-10) [Universum] MCMC-Verknüpfungsanalyse an allgemeinen Stammbäumen (PS-Handbuch) Looptools (2.8-1build3) [Universum] Integraler Evaluator des Einschleifen-Feynman-Diagramms lorene (0.0.0

cvs20161116+dfsg-1ubuntu6) [Universum] Framework für numerische Relativitätstheorie lorene-codes-src (0.0.0

cvs20161116+dfsg-1ubuntu6) [Universum] Quelldateien von LORENE-basierten Codes ltrift (1.0.2-8) [Universum] Nachbearbeitung und Klassifizierung von LTR-Retrotransposons lttoolbox-dev (3.5.1-2build2) [Universum] Entwicklungstools und Bibliothek für lttoolbox lucy (1.20-1) [Universum] DNA-Sequenzqualität und Vektortrimming-Tool lutefisk (1.0.7+dfsg-4build1) [Universum] De-novo-Interpretation von Peptid-CID-Spektren lxi-tools (1.21-1build1) [Universum] LAN eXtensions for Instrumentation (LXI) Softwareschnittstelle maffilter (1.3.1+dfsg-1build1) [Universum] Genom-Alignment im Multiple Alignment Format verarbeiten maffilter-examples (1.3.1+dfsg-1build1) [Universum] Genom-Alignment im Multiple Alignment Format verarbeiten (Beispieldaten) mafft (7.453-1) [Universum] Multiples Alignment-Programm für Aminosäure- oder Nukleotidsequenzen-Kartenschaden (2.2.0+dfsg-1) [Universum] Verfolgung und Quantifizierung von Schadensmustern in alten DNA-Sequenzen mapsembler2 (2.2.4+dfsg-3build2) [Universum] Bioinformatik zielgerichtete Assemblierungssoftware maq (0.7.1-8build1) [Universum] kartiert kurze polymorphe DNA-Sequenz-Reads mit fester Länge auf Referenzsequenzen maqview (0.2.5-9build1) [Universum] grafischer Read-Alignment-Viewer für kurze Gensequenzen mash (2.2.2+dfsg-1build1) [Universum] schnelle Genom- und Metagenom-Abstandsschätzung mit MinHash matlab-gdf (0.1.3-3ubuntu2) [Multiversum] IO-Bibliothek für das GDF -- Matlab-Schnittstelle maude (2.7-2build2) [Universum] leistungsstarkes logisches Framework mauve-aligner (2.4.0+4736-2build1) [Universum] multiples Genom-Alignment mayavi2 (4.7.1-2build1) [Universum] wissenschaftliches Visualisierungspaket für 2D- und 3D-Daten mbt (3.4-1build1) [Universum] speicherbasierter Tagger-Generator und Tagger-mbtserver (0.12-1build1) [Universum] Servererweiterungen für den MBT-Tagger meep (1.12.0-2build2) [Universum] Softwarepaket für FDTD-Simulation meep-mpi-default (1.12.0-2build2) [Universum] Softwarepaket für FDTD-Simulation, parallel (OpenMPI) Version meep-openmpi (1.12.0-3build2) [Universum] Softwarepaket für FDTD-Simulation, parallel (OpenMPI) Versionsschmelzen (5.2.0-1) [Universum] berechne die Schmelztemperatur von Nukleinsäureduplex metaphlan2 (2.9.22-1) [Universum] Metagenomische phylogenetische Analyse metaphlan2-Daten (2.6.0+ds-4) [Universum] Datenpaket für Metagenomic Phylogenetic Analysis metastudent (2.0.1-8) [Universum] Prädiktor von Genontologie-Begriffen aus Proteinsequenz-Metastudenten-Daten (2.0.1-4) [Universum] Prädiktor von Gen-Ontologie-Begriffen aus Proteinsequenz - Datendateien metastudent-data-2 (1.0.0-4) [Universum] Prädiktor für genontologische Begriffe aus der Proteinsequenz - Daten #2 Metview (5.7.5-1) [Universum] Interaktive Datenvisualisierungs- und Analyseumgebung, metview-data (5.7.5-1) [Universum] Daten, die für die Metview-Datenanalyseumgebung benötigt werden mhap (2.1.3+dfsg-2) [Universum] ortsabhängiges Hashing zur Erkennung von Überlappungen bei langen Lesevorgängen mia-doctools (2.4.6-5build3) [Universum] Hilfsskripte für die Laufzeitdokumenterstellung mia-tools (2.4.6-5build3) [Universum] Befehlszeilentools für die Graustufenbildverarbeitung mia-viewit (1.0.5-2build1) [Universum] Viewer-Programm für mit MIA mialmpick erstellte 3D-Datensätze (0.2.14-2) [Universum] Werkzeuge für die Orientierungspunktauswahl in 3D-Volumendatensätzen microbegps (1.0.0-5) [Universum] exploratives taxonomisches Profiling-Tool für metagenomische Daten microbiomeutil (20101212+dfsg1-3) [Universum] Microbiom Analysis Utilities microbiomeutil-data (20101212+dfsg1-3) [Universum] Referenz 16S-Sequenzen und NAST-Alignments verwendet von microbiomeutil tools microhope (4.6.2-1) [Universum] Hardware- und Software-Framework zum Erlernen von Mikrocontrollern minc-tools (2.3.00+dfsg-3build2) [Universum] MNI medizinische Bildformatwerkzeuge minia (1.6906-2) [Universum] Biologischer Sequenz-Assembler-Miniasmus (0.3+dfsg-1) [Universum] ultraschneller De-novo-Assembler für lange verrauschte DNA-Sequenzierung liest minimac4 (1.0.2-2build1) [Universum] Schnelle Imputation basierend auf State Space Reduction HMM Minimap (0,2-4) [Universum] Werkzeug zur ungefähren Kartierung langer Biosequenzen wie DNA liest minimap2 (2.17+dfsg-2) [Universum] vielseitiger paarweiser Aligner für genomische und gespleißte Nukleotidsequenzen minisat (1:2.2.1-5build2) [Universum] Schneller und leichter SAT-Solver minisat+ (1.0-4build1) [Universum] Solver für pseudo-Boolesche Beschränkungen minisat2 (1:2.2.1-5build2) [Universum] Übergangspaket für minisat minisat2 виртуальный пакет, предоставляемый minisat mipe (1.1-7) [Universum] Tools zum Speichern von PCR-abgeleiteten Daten Mira-Assembler (4.9.6-4build5) [Universum] Whole Genome Shotgun und EST Sequence Assembler mira-rfam-12s-rrna (4.9.6-4build5) [Universum] Extrakt der RFAM 12 rRNA Datenbank mirtop (0.4.23-1) [Universum] miRNAs mit einer Standard-Mirna/Isomir-Namensfehlanpassung annotieren (2.8.0-2) [Universum] Grundlegende Wartungs- und Paketierungsaufgaben für FITS-Dateien mitools (2.0.3-2build1) [Universum] Anzeigen, Konvertieren und Ausführen grundlegender Mathematik mit medizinischen Bilddatensätzen mldemos (0.5.1+git.1.ee5d11f-4) [Universum] Machine Learning Demos (MLDemos) mit Visualisierung mlpack-bin (3.2.2-3) [Universum] intuitive, schnelle, skalierbare C++-Bibliothek für maschinelles Lernen (Binärdateien) mlv-smile (1.47-6) [Universum] Finden Sie statistisch signifikante Muster in Sequenzen mmseqs2 (9-d36de+ds-4) [Universum] ultraschnelle und empfindliche Proteinsuche und Clustering mmseqs2-Beispiele (9-d36de+ds-4) [Universum] optionale Ressourcen für das mmseqs2-Paket mocassin (2.02.73-2) [Universum] MOnte-Carlo-Simulationen von Mokassin-Benchmarks mit ionisierten Nebeln (2.02.73-2) [Universum] Benchmarks für den Photoionisationscode MOCASSIN mocassin-data (2.02.73-2) [Universum] Atomare und optische Daten für den Photoionisationscode MOCASSIN Mocassin-Beispiele (2.02.73-2) [Universum] Beispiele für den Photoionisationscode MOCASSIN montage (6.0+dfsg-6build3) [Universum] Toolkit zum Zusammensetzen von FITS-Bildern zu Mosaiken montage-gridtools (6.0+dfsg-6build3) [Universum] Erstellen Sie Dateien zum Ausführen der Montage auf dem Raster montecarlo-base (20061220+dfsg3-3.1build4) [Universum] [Physik] Gemeinsame Dateien für CERNLIB Monte Carlo Bibliotheken montecarlo-data (20061220+dfsg3-3.1build4) [Universum] [Physik] Daten für CERNLIB Monte Carlo Bibliotheken mopac7-bin (1.15-6ubuntu4) [Universum] Semiempirische Quantenchemiebibliothek (Binärdateien) Morsesimulator (1.4-6build1) [Universum] Multi-OpenRobot Simulation Engine Morse-Simulator-Daten (1.4-6build1) [Universum] Multi-OpenRobot Simulation Engine mothur (1.42.1-1build1) [Universum] Sequenzanalyse-Suite für die Erforschung von Mikrobiota mpb (1.9.0-2) [Universum] MIT Photonic-Bands mpb-mpi (1.9.0-2) [Universum] MIT Photonic-Bands, parallel (mpich) Version mpb-scm (1.9.0-2) [Universum] MIT Photonic-Bands Initialisierungsdateien mpgrafic (0.3.18-1build1) [Universum] MPI-Version des N-Körper-Ausgangsbedingungen-Grafikpakets mpqc (2.3.1-19) [Universum] Massively Parallel Quantum Chemistry Program mpqc-support (2.3.1-19) [Universum] Massively Parallel Quantum Chemistry Program (Unterstützungstools) mpqc3 (0.0

git20170114-4.1) [Universum] Massively Parallel Quantum Chemistry Program mpqc3-data (0.0

git20170114-4.1) [Universum] Massively Parallel Quantum Chemistry Program (Datendateien) mptp (0.2.4-1) [Universum] Abgrenzung von Einzelstandorten mrbayes-mpi (3.2.6+dfsg-2ubuntu2) [Universum] Bayessche Inferenz der Phylogenie - mpi-Version mriconvert (1:2.1.0-4build1) [Universum] Dienstprogramm zur Konvertierung von medizinischen Bilddateien mricron (0.20140804.1

dfsg.1-3) [Universum] Magnetresonanz-Bildkonvertierung, Anzeige und Analyse von Mikron-Daten (0.20140804.1 .)

dfsg.1-3) [Universum] Datendateien für MRicron mrs (6.0.5+dfsg-7build7) [Universum] Information Retrieval System für biomedizinische Datenbanken mrtrix3 (3.0

rc3+git135-g2b8e7d0c2-5) [Universum] diffusionsgewichtete MRT Traktographie der weißen Substanz mseed2sac (2,3+ds1-1) [Universum] Konvertieren von MiniSEED-Zeitreihendaten in SAC mssstest (3.0-7build1) [Multiversum] Normalisierung der Krankheits-Scores für Patienten mit Multipler Sklerose msxpertsuite (5.8.6-2build1) [Universum] Massenspektrometrie-Software-Suite - Metapaket msxpertsuite-massxpert (5.8.6-2build1) [Universum] Massenspektrometrie-Software-Suite - massXpert msxpertsuite-massxpert-data-doc (5.8.6-2build1) [Universum] Massenspektrometrie-Software-Suite - massXpert - Daten und Dokumente msxpertsuite-minexpert (5.8.6-2build1) [Universum] Massenspektrometrie-Software-Suite - mineXpert msxpertsuite-minexpert-data-doc (5.8.6-2build1) [Universum] Massenspektrometrie-Software-Suite - mineXpert - Daten- und Dokumentationsmummer (3.23+dfsg-4build1) [Universum] Effizientes Sequenz-Alignment von vollständigen Genomen munipack (0.5.11-2.1build1) [Universum] Astronomisches Photometrie-Softwarepaket munipack-cli (0.5.11-2.1build1) [Universum] Kommandozeilenschnittstelle von Munipack munipack-core (0.5.11-2.1build1) [Universum] Kernroutinen von Munipack munipack-gui (0.5.11-2.1build1) [Universum] Grafische Benutzeroberfläche von Munipack murasaki (1.68.6-9build2) [Universum] Homologie-Erkennungswerkzeug über mehrere große Genome murasaki-common (1.68.6-9build2) [Universum] Homologie-Erkennungstool über mehrere große Genome (gemeinsame Dateien) murasaki-mpi (1.68.6-9build2) [Universum] Homologie-Erkennungswerkzeug über mehrere große Genome (MPI-Version) Muskel (1:3.8.1551-2build1) [Universum] Multiples Alignment-Programm von Proteinsequenzen music-bin (1.1.16-1.1build2) [Universum] Multi-Simulations-Koordinator für MPI -- Dienstprogramme mustang (3.2.3-3build1) [Universum] multipler struktureller Alignment von Proteinen mustang-testdata (3.2.3-3build1) [Universum] multipler struktureller Alignment von Proteinen, Testdaten nanook (1.33+dfsg-1) [Universum] Pre- und Post-Alignment-Analyse von Nanoporen-Sequenzierungsdaten nanopolish (0.11.3-1build1) [Universum] Konsensus-Aufrufer für Nanoporen-Sequenzierungsdaten nast-ier (20101212+dfsg1-3) [Universum] NAST-basiertes DNA-Alignment-Tool Nastran (0.1.95-1build3) [Multiversum] NASA-Strukturanalysesystem nautisch (1.5-4build1) [Universum] Berechnung der Beobachterposition in der Astro-Navigation ncbi-blast+ (2.9.0-2) [Universum] Suite der nächsten Generation von BLAST-Sequenzsuchwerkzeugen ncbi-blast+-legacy (2.9.0-2) [Universum] NCBI Blast Legacy-Aufrufskript ncbi-cn3d (3.0.20170106+dfsg1-8) [Universum] 3-dimensionaler Viewer für biologische Moleküle ncbi-entrez-direct (12.0.20190816+ds-1) [Universum] NCBI Entrez-Dienstprogramme auf der Befehlszeile ncbi-epcr (2.3.12-1-8build1) [Universum] Tool zum Testen einer DNA-Sequenz auf das Vorhandensein von sequenzmarkierten Stellen ncbi-rrna-data (6.1.20170106+dfsg1-8) [Universum] große rRNA-BLAST-Datenbanken, die mit dem NCBI-Toolkit ncbi-seg (0.0.200000620-5) verteilt werden [Universum] Werkzeug zum Maskieren von Segmenten geringer kompositorischer Komplexität in Aminosäuresequenzen ncbi-tools-bin (6.1.20170106+dfsg1-8) [Universum] NCBI-Bibliotheken für Biologieanwendungen (textbasierte Dienstprogramme) ncbi-tools-x11 (6.1.20170106+dfsg1-8) [Universum] NCBI-Bibliotheken für Biologieanwendungen (X-basierte Dienstprogramme) ncl-ncarg (6.6.2-1build4) [Universum] NCAR-Befehlssprache und NCAR-Grafik ncl-tools (2.1.21+git20190531.feceb81-2build1) [Universum] Tools zum Umgang mit NEXUS-Dateien ncoils (2002-7) [Universum] Coiled-Coil-Sekundärstrukturvorhersage ncview (2.1.8+ds-3build2) [Universum] X11 visueller Browser für NetCDF-Formatdateien ordentlich (2.2-1build1) [Universum] Nebuläres empirisches Analysetool neobio (0.0.20030929-4) [Universum] berechnet Alignments von Aminosäure- und Nukleotidsequenzen netcdf-bin (1:4.7.3-1) [Universum] Programme zum Lesen und Schreiben von NetCDF-Dateien neuron (7.6.3-1build4) [Universum] Simulationsumgebung für Computermodelle von Neuronen neuron-dev (7.6.3-1build4) [Universum] Neuron-Simulationsumgebung - Entwicklungsdateien nexus-tools (4.4.3-4) [Universum] NeXus-Dateiformat für wissenschaftliche Daten - Anwendungen nifti2dicom (0.4.11-1.1build1) [Universum] Konvertieren von medizinischen 3D-Bildern in DICOM 2D-Serie nifti2dicom-Daten (0.4.11-1.1build1) [Universum] Datendateien für nifti2dicom njplot (2.4-8) [Universum] Stammbaum-Zeichnungsprogramm node-sphericalmercator (1.0.1-2) [Universum] Sphärische Mercator-Projektionsunterstützung für NodeJS node-srs (0.4.8+dfsg-4ubuntu2) [Universum] Raumbezugsbibliothek für Node.js norsnet (1.0.17-6) [Universum] Werkzeug zur Identifizierung unstrukturierter Schleifen in Proteinen norsp (1.0.6-4) [Universum] Prädiktor der nicht-regulären Sekundärstruktur numdiff (5.9.0-1) [Universum] Vergleiche ähnliche Dateien mit numerischen Feldern nutqlite (2.0.6-1) [Universum] Ernährungsanalyse-Software nwchem (7.0.0-2) [Universum] Hochleistungs-Computerchemie-Software nwchem-data (7.0.0-2) [Universum] Hochleistungs-Computerchemie-Software (Datendateien) oar-common (2.5.8-2) [Universum] OAR-Batch-Scheduler allgemeines Paket oar-node (2.5.8-2) [Universum] OAR-Batch-Scheduler-Knotenpaket oar-restful-api (2.5.8-2) [Universum] OAR-Webdienste oar-server (2.5.8-2) [Universum] OAR-Batch-Scheduler-Serverpaket oar-server-mysql (2.5.8-2) [Universum] OAR-Batch-Scheduler MySQL-Server-Backend-Paket oar-server-pgsql (2.5.8-2) [Universum] OAR-Batch-Scheduler PostgreSQL-Server-Backend-Paket oar-user (2.5.8-2) [Universum] OAR-Batch-Scheduler-Benutzerpaket oar-user-mysql (2.5.8-2) [Universum] OAR-Batch-Scheduler MySQL-Benutzer-Backend-Paket oar-user-pgsql (2.5.8-2) [Universum] OAR-Batch-Scheduler PostgreSQL-Benutzer-Backend-Paket oar-web-status (2.5.8-2) [Universum] OAR-Batch-Scheduler-Visualisierungstool-Paket occt-draw (7.3.3+dfsg1-1build1) [Universum] Open CASCADE Technology Befehlsinterpreter und grafisches Testsystem oce-draw (0.18.3-1build1) [Universum] OpenCASCADE Community Edition CAE-Plattform gemeinsam genutzte Bibliothek octave-bart (0.5.00-1) [Universum] Oktavbindungen für BART octave-gdf (0.1.3-3ubuntu2) [Universum] IO-Bibliothek für das GDF -- Octave-Interface octave-psychtoolbox-3 (3.0.16.20200130.dfsg1-1) [Universum] Toolbox für Sehforschung -- Octave Bindings octomap-tools (1.9.3+dfsg-2) [Universum] Tools für 3D-Belegungsraster-Mapping octovis (1.9.3+dfsg-2) [Universum] Visualisierungstool für OctoMap odil (0.11.0-1build1) [Universum] C++11-Bibliothek für den DICOM-Standard (Anwendung) odin (2.0.3-2build1) [Universum] Magnetresonanzsequenzen entwickeln, simulieren und ausführen ogdi-bin (4.1.0+ds-1build1) [Universum] Open Geographic Datastore Interface Library -- Utilities ompl-demos (1.4.2+ds1-5) [Universum] Open Motion Planning Library (OMPL) Demos ompl-plannerarena (1.4.2+ds1-5) [Universum] Open Motion Planning Library (OMPL) plannerarena openbabel (3.0.0+dfsg-3ubuntu3) [Universum] Chemische Toolbox-Dienstprogramme (cli) openbabel-gui (3.0.0+dfsg-3ubuntu3) [Universum] Chemical Toolbox Utilities (grafische Benutzeroberfläche) opencaster (3.2.2+dfsg-1.1build2) [Universum] MPEG2-Transportstrom-Datengenerator und Paketmanipulator openfoam (1906.191111+dfsg1-2build1) [Universum] Open Source Toolbox für Computational Fluid Dynamics (CFD) - Binaries openfoam-examples (1906.191111+dfsg1-2build1) [Universum] Open-Source-Toolbox für Computational Fluid Dynamics (CFD) - Beispiele openmolcas (19.11-1build1) [Universum] Quantenchemie-Softwarepaket openmolcas-data (19.11-1build1) [Universum] Quantenchemie-Softwarepaket (Datendateien) openms (2.4.0-real-1ubuntu4) [Universum] Paket für LC/MS-Datenmanagement und -analyse openms-common (2.4.0-real-1ubuntu4) [Universum] Paket für LC/MS-Datenmanagement und -analyse - Shared Data openmx (3.8.5+dfsg1-1build1) [Universum] Paket für nanoskalige Materialsimulationen openmx-data (3.8.5+dfsg1-1build1) [Universum] Paket für nanoskalige Materialsimulationen (Daten) openrocket (15.03.5) [Universum] Modell Rocket Simulator Openturns-Beispiele (1.14-1ubuntu3) [Universum] Beispiele für OpenTURNS-Funktionalitäten openuniverse (1.0beta3.1+dfsg-6build1) [Universum] 3D Universe Simulator openuniverse-common (1.0beta3.1+dfsg-6build1) [Universum] 3D Universe Simulator Datendateien optgeo (2.25-1) [Universum] Simulator für optische Raytracer mit geometrischer Optik (9.6-1) [Universum] Virtueller Linsen-/Spiegeldesign-Workshop optimir (1.0-2) [Universum] Integration genetischer Variationen in miRNA-Alignment-Origami (1.2.7+really0.7.4-1.1) [Universum] Befehlszeilen-Verwaltungstool für Folding @ Home-Clients orthanc (1.5.8+dfsg-2ubuntu6) [Universum] Leichter, RESTful DICOM-Server für die medizinische Bildgebung orthanc-dicomweb (1.0+dfsg-2ubuntu10) [Universum] Plugin zur Erweiterung von Orthanc mit Unterstützung von WADO und DICOMweb orthanc-imagej (1.2+dfsg-1) [Universum] ImageJ-Plugin zum Importieren von Bildern aus Orthanc orthanc-mysql (2.0-2ubuntu5) [Universum] Plugins zur Verwendung von MySQL oder MariaDB als Datenbank-Backend für Orthanc orthanc-postgresql (3.2-1ubuntu4) [Universum] Plugins zur Verwendung von PostgreSQL als Datenbank-Backend für Orthanc orthanc-webviewer (2.5-2ubuntu4) [Universum] Web-Viewer medizinischer Bilder für Orthanc orthanc-wsi (0.6-2ubuntu5) [Universum] Unterstützung der Ganzdia-Bildgebung für Orthanc (digitale Pathologie)-Oscar (1.1.0-testing-3-3build1) [Universum] Open Source CPAP Analysis Reporter (OSCAR) ossim-core (2.9.1-2build1) [Universum] OSSIM-Kerndienstprogramme otb-bin (7.0.0+dfsg-2build3) [Universum] ORFEO Toolbox-Befehlszeilenanwendungen otb-bin-qt (7.0.0+dfsg-2build3) [Universum] ORFEO Toolbox grafische Benutzeroberflächenanwendungen otb-testdriver (7.0.0+dfsg-2build3) [Universum] ORFEO Toolbox Bibliothek - OTBTestDriver otf-trace (1.12.5+dfsg-6build1) [Universum] Open Trace Format Unterstützungsbibliothek - Entwicklungsdateien packmol (20.010-1build1) [Universum] Erste Konfigurationen für Molecular Dynamics Simulations paje.app (1.98-1build7) [Universum] generisches Visualisierungstool (Gantt-Diagramm und mehr) pal2nal (14.1-2) [Universum] wandelt Proteine ​​in genomische DNA-Alignment-Paml (4.9j+dfsg-1) um [Universum] Phylogenetische Analyse nach Maximum Likelihood (PAML) Paraclu (9-2build1) [Universum] Parametrisches Clustering von genomischen und transkriptomischen Merkmalen parafly (0.0.2013.01.21-4build1) [Universum] parallele Befehlsverarbeitung mit OpenMP paraview (5.7.0-4ubuntu9) [Universum] Parallele Visualisierungsanwendung parsinsert (1.04-5) [Universum] Sparsam Einfügen unklassifizierter Sequenzen in phylogenetische Bäume parsinsert-testdata (1.04-5) [Universum] Testdaten für parsinsert parsnp (1.2.1+dfsg-1build1) [Universum] Rapid Core Genome Multi-Alignment Patman (1.2.2+dfsg-6build1) [Universum] schnelles Alignment kurzer Sequenzen an großen Datenbanken paw (1:2.14.04.dfsg.2-9.1build4) [Universum] Physics Analysis Workstation - ein grafisches Analyseprogramm paw++ (1:2.14.04.dfsg.2-9.1build4) [Universum] Physics Analysis Workstation (Lesstif-erweiterte Version) paw-common (1:2.14.04.dfsg.2-9.1build4) [Universum] Physics Analysis Workstation (gemeinsame Dateien) paw-demos (1:2.14.04.dfsg.2-9.1build4) [Universum] Physics Analysis Workstation Beispiele und Tests pbbamtools (1.0.6+dfsg-2build1) [Universum] Verarbeitung von binären Alignment-/Map-Dateien von Pacific Biosciences pbdagcon (0.3+git20180411.c14c422+dfsg-1build1) [Universum] Sequenzkonsens unter Verwendung gerichteter azyklischer Graphen pbhoney (15.8.24+dfsg-4) [Universum] Entdeckung genomischer struktureller Variation pbjelly (15.8.24+dfsg-4) [Universum] Genom-Assembly-Upgrade-Tool pbsim (1.0.3+git20180330.e014b1d+dfsg-1build1) [Universum] Simulator für die PacBio-Sequenzierung liest Perlprimer (1.2.4-1) [Universum] Grafisches Design von Primern für die PCR perlprimer-doc (1.2.4-1) [Universum] Tutorial zu perlprimer perm (0.4.0-4build1) [Universum] effizientes Mapping von kurzen Reads mit periodisch beabstandeten Seeds pftools (3+dfsg-3) [Universum] Erstellen und Durchsuchen von Protein- und DNA-generalisierten Profilen phast (1.5+dfsg-1) [Universum] phylogenetische Analyse mit Raum-Zeit-Modellen phipack (0.0.20160614-3build1) [Universum] PHI-Test und andere Tests von Rekombinationsphybin (0.3-3build3) [Universum] Binning/Clustering von Newick-Bäumen nach Topologie-Phylip (1:3.697+dfsg-1) [Universum] Programmpaket zum Ableiten von Phylogenien phylip-doc (1:3.697+dfsg-1) [Universum] Programmpaket zum Ableiten von Phylogenien (Dokumentation) phylonium (1.2-1build1) [Universum] Schnelle und genaue Schätzung evolutionärer Distanzen phyml (3:3.3.20190909-1) [Universum] Phylogenetische Schätzung mit Maximum-Likelihood-Physamp (1.1.0-1build1) [Universum] Probensequenz-Alignment entsprechend der Phylogenie Phyutility (2.7.3+dfsg-2) [Universum] einfache Analysen oder Modifikationen sowohl an phylogenetischen Bäumen als auch an Datenmatrizen phyx (1.01+ds-1build1) [Universum] Phylogenetische Analysen im UNIX-Stil an Bäumen und Sequenzen picard-tools (2.18.25+dfsg-2) [Universum] Befehlszeilentools zum Bearbeiten von SAM- und BAM-Dateien Picosat (965-1) [Universum] SAT-Löser mit Proof- und Kernstützpfahl (0

20140707-2build1) [Universum] genomische Wiederholungsanalyse Pilercr (1.06+dfsg-2build1) [Universum] Software zum Auffinden von CRISPR-Wiederholungen Pilon (1.23+dfsg-1) [Universum] Automatisierte Genom-Assembly-Verbesserung und Variantenerkennungs-Tool pirs (2.0.2+dfsg-8build1) [Universum] Profilbasierte Illumina pair-end Reads Simulator pirs-examples (2.0.2+dfsg-8build1) [Universum] Profil basd Illumina pair-end Reads Simulator (Beispieldaten) pirs-profiles (2.0.2+dfsg-8build1) [Universum] Profil basd Illumina pair-end Reads Simulator (Profildaten) pkg-r-autopkgtest (20200104) [Universum] Skript zum automatischen Testen von R-Paketen pktools (2.6.7.6+ds-2build2) [Universum] GDAL-Add-On-Tools zur Durchführung nützlicher Rasterverarbeitungsplacnet (1.03-3) [Universum] Plasmid Constellation Network Projektplaneten (0.1.13-20) [Universum] Gravitationssimulation planetarischer Körper Plasmidseeker (1.0+dfsg-1) [Universum] Identifizierung bekannter Plasmide aus der Sequenzierung des gesamten Genoms liest plast (2.3.2+dfsg-1build1) [Universum] Suchwerkzeug für parallele lokale Sequenzausrichtung plast-example (2.3.2+dfsg-1build1) [Universum] Parallel Local Sequence Alignment Search Tool (Beispieldaten) plastimatch (1.8.0+dfsg.1-2build1) [Universum] medizinische Bildrekonstruktion und Registrierung plink (1.07+dfsg-3build1) [Universum] Toolset zur Assoziationsanalyse des gesamten Genoms plink1.9 (1.90

b6.16-200217-1) [Universum] Toolset zur Assoziationsanalyse des gesamten Genoms plink2 (2,00

a3-200217+dfsg-1) [Universum] Toolset zur Assoziationsanalyse des gesamten Genoms pluto-jpl-eph (0.0

git20180228-1.1build1) [Universum] Befehlszeilenbehandlung von JPL-Ephemeren Daten pluto-lunar (0.0

git20180825.e34c1d1-1build1) [Universum] Routinen zur Vorhersage von Positionen im Sonnensystem pnetcdf-bin (1.12.1-1ubuntu2) [Universum] Programme zum Lesen und Schreiben paralleler NetCDF-Dateien poa (2.0+20060928-7) [Universum] Partial Order Alignment für multiple Sequenz-Alignment-Populationen (1.2.33+svn0120106+dfsg-3build1) [Universum] Populationsgenetische Software Porechop (0.2.4+dfsg-1build2) [Universum] Adaptertrimmer für Oxford Nanopore liest Porentools (0.6.0+dfsg-4) [Universum] Toolkit für Nanopore-Nukleotid-Sequenzierungsdaten poretools-data (0.6.0+dfsg-4) [Universum] Toolkit für Nanoporen-Nukleotidsequenzierungsdaten -- Beispieldatensätze pp-popularity-contest (1.0.6-4build1) [Universum] PredictProtein Popularitätswettbewerb praat (6.1.09-1build1) [Universum] Programm für Sprachanalyse und Synthesestreich (0.0.170427+dfsg-2build1) [Universum] Probabilistic Alignment Kit für DNA-, Codon- und Aminosäuresequenzen vorhersagen (1.0.20-6) [Universum] Vorhersage und Analyse von Proteinkernlokalisationssignalen prime-phylo (1.0.11-8build1) [Universum] Bayessche Schätzung von Genbäumen unter Berücksichtigung des Artenbaums Primer3 (2.4.0-2) [Universum] Werkzeug zum Design flankierender Oligonukleotide für DNA-Amplifikationsprimer3-Beispiele (2.4.0-2) [Universum] Werkzeug zum Design flankierender Oligonukleotide für die DNA-Amplifikation (Beispiele) proalign (0.603-4) [Universum] Probabilistisches multiples Alignment-Programm wahrscheinlich (0.5.0+dfsg-3build1) [Universum] Toolset für genomweite Assoziationsanalyse probabel-examples (0.5.0+dfsg-3build1) [Universum] Beispieldateien für ProbABEL probalign (1.4-8build1) [Universum] Mehrfachsequenz-Alignment unter Verwendung von Partitionsfunktion Posterior-Wahrscheinlichkeiten Probcons (1.12-12build1) [Universum] PROBabilistic CONSistency-based multiple Sequence Alignment probcons-extra (1.12-12build1) [Universum] Zusatzprogramme aus dem probcons-Paket proda (1.0-12build1) [Universum] multiples Alignment von Proteinsequenzen verloren (1:2.6.3-4) [Universum] Mikrobielles (bakterielles und archaeales) Genfindungsprogramm Profbval (1.0.22-6) [Universum] Prädiktor für flexible/starre Proteinreste aus Sequenzprofisse (1.0.11-5) [Universum] Vorhersage von Protein-Protein-Interaktionsstellen aus der Sequenz profnet-bval (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für profbval profnet-chop (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für profchop profnet-con (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für profcon profnet-isis (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für profisis profnet-md (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für Metastörung profnet-norsnet (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für norsnet profnet-prof (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für profacc profnet-snapfun (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für snapfun profphd-net (1.0.22-6build1) [Universum] neuronale Netzwerkarchitektur für profphd profphd-utils (1.0.10-5build1) [Universum] profphd-Hilfsprogramme convert_seq und filter_hssp proftmb (1.1.12-8build1) [Universum] Pro-Rest-Vorhersage von bakteriellen transmembranen Betafässern progressivemauve (1.2.0+4713+dfsg-4build1) [Universum] mehrere Genom-Alignment-Algorithmen proj-bin (6.3.1-1) [Universum] Kartographische Projektionsbibliothek (Werkzeuge) proj-rdnap (2008+2018-4) [Multiversum] RDNAP-Gitterkorrekturdateien für PROJ prokka (1.14.5+dfsg-2) [Universum] schnelle Annotation prokaryotischer Genome Prooftree (0.13-1build9) [Universum] Beweisbaum-Visualisierung für Proof General proteinortho (6.0.14+dfsg-1) [Universum] Nachweis von (Co-)Orthologen im groß angelegten Proteinanalyseprotest (3.4.2+dfsg-3) [Universum] Auswahl der am besten geeigneten Modelle der Proteinevolution pscan-chip (1.1-2build1) [Universum] ChIP-basierte Identifizierung von TF-Bindungsstellen pscan-chip-data (1.1-2build1) [Universum] Hilfsdaten für PScan-ChIP pscan-tfbs (1.2.2-3build1) [Universum] Suche nach Transkriptionsfaktor-Bindungsstellen psfex (3.17.1+dfsg-5build2) [Universum] Point Spread Funktionsmodellextraktor psi3 (3.4.0-6ubuntu1) [Universum] Quantum Chemical Program Suite psi4 (1:1.3.2-3build2) [Universum] Quantum Chemical Program Suite psi4-Daten (1:1.3.2-3build2) [Universum] Quantum Chemical Program Suite (Datendateien) psortb (3.0.6+dfsg-2) [Universum] Werkzeug zur Vorhersage der bakteriellen Lokalisation psychopy (2020.1.3+dfsg-2) [Universum] Umgebung zum Erstellen von psychologischen Stimuli in Python psychtoolbox-3-common (3.0.16.20200130.dfsg1-1) [Universum] Toolbox für die Sehforschung -- arch/interpreter unabhängiger Teil psychtoolbox-3-lib (3.0.16.20200130.dfsg1-1) [Universum] Toolbox für Sehforschung -- bogenspezifische Teile reinigen (2.0.0-4build4) [Universum] Sammlung von Routinen für die radiointerferometrische Bildgebung pyfai (0.19.0+dfsg1-1build1) [Universum] Schnelle azimutale Integrationsskripte pyfr (1.5.0-3) [Universum] Flussrekonstruktion in Python pylang (0.0.4-0ubuntu3) [Universum] Vervollständigen Sie den richtigen Satz mit zufällig generierten Wörtern. pymca (5.5.4+dfsg-1build1) [Universum] Anwendungen und Toolkit für die Röntgenfluoreszenzanalyse -- Skripte pymca-data (5.5.4+dfsg-1build1) [Universum] Architekturunabhängige Datendateien für PyMca pymoctool (0.5.0-4) [Universum] Python Multi-Order Coverage Maps-Tool für Virtual Observatory pymol (2.3.0+dfsg-1build1) [Universum] Molecular Graphics System Pymol-Daten (2.3.0+dfsg-1build1) [Universum] Datendateien für PyMOL pythia8-data (8.1.86-1.2build1) [Universum] PYTHIA8-Datendateien python-drizzle-testdata (1.13.1-2build2) [Universum] Dithered-Image-Kombination für Python (Testdaten) python-escript-doc (5.5-5) [Universum] Dokumentation für Escript/Finley python-nifti (0.20100607.1-4.1build1) [Universum] Python-Schnittstelle zu den NIfTI-I/O-Bibliotheken python-pyode (1.2.0-4+cvs20090320.3build2) [Universum] Python-Bindungen für The Open Dynamics Engine python3-airr (1.2.1-2) [Universum] Datendarstellung Standardbibliothek für Antikörper- und TCR-Sequenzen python3-alignlib (0.1.1+dfsg-1ubuntu2) [Universum] Bearbeiten und Hamming-Abstände für biologische Sequenzen python3-amp (0.6.1-1build2) [Universum] Atomistisches Maschinenlernpaket (Python 3) python3-escript (5.5-5) [Universum] Escript/Finley Finite Elemente Python3-System (mit OpenMP) python3-escript-mpi (5.5-5) [Universum] Escript/Finley Finite Elemente Python3-System (OpenMP + MPI) python3-gfapy (1.0.0+dfsg-4build1) [Universum] flexible und erweiterbare Softwarebibliothek zur Handhabung von Sequenzgraphen python3-gffutils (0.10.1-2) [Universum] Arbeiten Sie mit GFF- und GTF-Dateien in einem flexiblen Datenbank-Framework python3-jupyter-sphinx (0.2.3-1) [Universum] Jupyter Sphinx-Erweiterung - Python3 python3-louvain (0.0+20181013git3fc1f575-1ubuntu1) [Universum] Community-Graph-Analyse, die die Louvain-Methode Python3-Morse-Simulator (1.4-6build1) implementiert [Universum] Multi-OpenRobot Simulation Engine python3-noise (1.2.3-3) [Universum] Perlin-Rauschen für die Bilderzeugung python3-py2bit (0.3.0-3build1) [Universum] Zugriff auf 2bit-Dateien python3-pybel (0.12.1-1) [Universum] Biologische Ausdruckssprache python3-pybigwig (0.3.17-1build2) [Universum] Python 3-Modul für den schnellen Zugriff auf bigBed- und bigWig-Dateien python3-pynlpl (1.2.9-1) [Universum] PyNLPl ist eine Bibliothek für Natural Language Processing (Python 3-Version) python3-tinyalign (0.2-3) [Universum] numerische Darstellung der Unterschiede zwischen den Strings pyzo (4.4.3-1.2) [Universum] interaktiver Editor für wissenschaftliche Python q2templates (2019.10.0+dfsg-1) [Universum] Designvorlagenpaket für QIIME 2 Plugins qcumber (1.0.14+dfsg-1) [Universum] Qualitätskontrolle genomischer Sequenzen qfits-tools (6.2.0-8ubuntu2) [Universum] FITS-Manipulationswerkzeuge qfitsview (4.0+dfsg-2build1) [Universum] FITS Dateibetrachter basierend auf DPUSER qgis (3.10.4+dfsg-1ubuntu2) [Universum] Geographisches Informationssystem (GIS) qgis-api-doc (3.10.4+dfsg-1ubuntu2) [Universum] QGIS API Dokumentation qgis-common (3.10.4+dfsg-1ubuntu2) [Universum] QGIS - architekturunabhängige Daten qgis-plugin-grass (3.10.4+dfsg-1ubuntu2) [Universum] GRASS-Plugin für QGIS qgis-plugin-grass-common (3.10.4+dfsg-1ubuntu2) [Universum] GRASS-Plugin für QGIS - architekturunabhängige Daten qgis-provider-grass (3.10.4+dfsg-1ubuntu2) [Universum] GRASS Provider für QGIS qgis-Provider (3.10.4+dfsg-1ubuntu2) [Universum] Sammlung von Datenprovidern zu QGIS qgis-providers-common (3.10.4+dfsg-1ubuntu2) [Universum] Sammlung von Datenprovidern zu QGIS - architekturunabhängige Dateien qgis-server (3.10.4+dfsg-1ubuntu2) [Universum] QGIS-Server, der verschiedene OGC-Dienste bereitstellt qgis3-survex-import (1.2-1) [Universum] QGIS3-Plugin zum Lesen von Survex-3D-Dateien, zur Höhlenvermessung qmapshack (1.14.0-1build2) [Universum] GPS-Mapping (GeoTiff und Vektor) und GPSr-Management qmc (0.94-3.1build1) [Universum] Quine McClusky Vereinfachungstool qnifti2dicom (0.4.11-1.1build1) [Universum] Konvertieren von medizinischen 3D-Bildern in die DICOM 2D-Serie (gui) qrisk2 (0.1.20150729-4) [Universum] Risikorechner für Herz-Kreislauf-Erkrankungen qthid-fcd-controller (4.1-5build1) [Universum] Funcube Dongle-Controller qtltools (1.2+dfsg-2build1) [Universum] Toolset für molekulare QTL-Entdeckung und -Analyse Quanten-Espresso (6.4.1-1build2) [Universum] Electronic-Structure und Ab-Initio Molecular Dynamics Suite Quanten-Espresso-Daten (6.4.1-1build2) [Universum] Elektronische Struktur und Ab-Initio Molecular Dynamics Suite (Dokumentation) Quorum (1.1.1-2build1) [Universum] qualitätsoptimierte Reads genomischer Sequenzen qutemol (0.4.1

cvs20081111-13build1) [Universum] interaktive Visualisierung von Makromolekülen r-Cran-Farbraum (1.4-1+dfsg-1) [Universum] GNU R-Farbraummanipulation r-cran-epibasix (1.5-1) [Universum] GNU R Elementare epidemiologische Funktionen r-Cran-Genetik (1.3.8.1.2-1) [Universum] GNU R-Paket für Populationsgenetik r-cran-haplo.stats (1.7.9-4) [Universum] GNU R-Paket zur Haplotypanalyse r-cran-maptools (1:0.9-9+dfsg-1) [Universum] GNU R Tools zum Lesen und Handhaben von räumlichen Objekten r-cran-msm (1.6.8-1) [Universum] GNU R Multi-State-Markov- und Hidden-Markov-Modelle im zeitkontinuierlichen r-cran-randomforest (4.6-14-2) [Universum] GNU R-Paket implementiert den Random Forest-Klassifikator r-cran-sdmtools (1.1-221.2-1) [Universum] Tools zur Modellierung der Artenverteilung r-cran-sp (1:1.4-0-1) [Universum] GNU R-Klassen und -Methoden für Geodaten r-cran-spc (1:0.6.3-1) [Universum] GNU R Statistical Process Control r-cran-surveillance (1.17.3-1build1) [Multiversum] GNU R-Paket zur Modellierung und Überwachung epidemischer Phänomene r-cran-vcd (1:1.4-5-1) [Universum] GNU R Visualisierung kategorialer Daten r-cran-xtable (1:1.8-4-1) [Universum] GNU R erzwingt Daten in LaTeX- und HTML-Tabellen racon (1.4.10-1build1) [Universum] Konsensus-Modul für rohe de novo DNA-Assemblierung von langen unkorrigierten Reads Radiant (2.7.1+dfsg-1) [Universum] Erkunden Sie hierarchische metagenomische Daten mit zoombaren Tortendiagrammen Ragout (2.2+ds-1build2) [Universum] Reference-Assisted Genome Ordering UTility Ragout-Beispiele (2.2+ds-1build2) [Universum] Reference-Assisted Genome Ordering UTility (Beispieldaten) rambo-k (1.21+dfsg-3) [Universum] Lesezuweisungsmethode basierend auf K-mers rampler (1.1.1-1build1) [Universum] Modul zur Probenahme genomischer Sequenzen rapmap (0.15.0+dfsg-1) [Universum] schnelles sensitives und genaues DNA-Read-Mapping über Quasi-Mapping rapmap-dev (0.15.0+dfsg-1) [Universum] rapmap - schnelles sensitives und genaues DNA-Read-Mapping (einige Header) rapmap-example-data (0.15.0+dfsg-1) [Universum] Beispieldaten für Rapmap - schnelles sensitives und genaues DNA-Read-Mapping rasmol (2.7.6.0-1build1) [Universum] Visualisierung biologischer Makromoleküle rasmol-doc (2.7.6.0-1build1) [Universum] Dokumentation für rasmol raster3d (3.0-4-1build1) [Multiversum] Tools zum Generieren von Bildern von Proteinen oder anderen Molekülen rate4site (3.0.0-6build1) [Universum] Detektor für konservierte Aminosäurestellen Rawtran (1.1-1build1) [Universum] RAW-Foto zu FITS-Konverter raxml (8.2.12+dfsg-4) [Universum] Randomisierte Axelerated Maximum Likelihood of phylogenetic tree ray (2.3.1-7build1) [Universum] de novo Genom-Assemblies von Next-Gen-Sequenzierungsdaten ray-extra (2.3.1-7build1) [Universum] Skripte und XSL-Sheets zur Nachbearbeitung für Ray-rdkit-Daten (201909.1-2ubuntu5) [Universum] Sammlung von Chemieinformatik und Machine-Learning-Software (Datendateien) rdp-classifier (2.10.2-4) [Universum] erweiterbarer Sequenzklassifikator für Pilz-Isu, Bakterien und Archaeen 16s readseq (1-13) [Universum] Konvertierung zwischen Sequenzformaten reapr (1.0.18+dfsg-5build1) [Universum] universelles Werkzeug zur Genom-Assembly-Evaluierung refmac-dictionary (5.41-1) [Universum] Wörterbuch für makromolekulare Verfeinerung und Modellbildung relion-bin (1.4+dfsg-4) [Universum] Toolkit für 3D-Rekonstruktionen in der Kryo-Elektronenmikroskopie relion-bin+gui (1.4+dfsg-4) [Universum] paralleles Toolkit für 3D-Rekonstruktionen in der Kryo-Elektronenmikroskopie relion-bin+mpi (1.4+dfsg-4) [Universum] paralleles Toolkit für 3D-Rekonstruktionen in der Kryo-Elektronenmikroskopie relion-bin+mpi+gui (1.4+dfsg-4) [Universum] paralleles Toolkit für 3D-Rekonstruktionen in der Kryo-Elektronenmikroskopie repeatmasker-recon (1.08-4) [Universum] findet Wiederholungsfamilien aus biologischen Sequenzen reprof (1.0.1-7) [Universum] Protein-Sekundärstruktur- und Zugänglichkeitsprädiktor Resfinder (3.2-1) [Universum] Erworbene antimikrobielle Resistenzgene identifizieren resfinder-db (0.0+git20191001.149209d-1) [Universum] ResFinder-Datenbank ist eine kuratierte Datenbank erworbener Resistenzgene resfinder-Beispiel (3.2-1) [Universum] Erworbene Antibiotikaresistenzgene identifizieren (Beispieldaten) rna-star (2.7.3a+dfsg-1build2) [Universum] ultraschneller universeller RNA-seq-Aligner rnahybrid (2.1.2-5) [Universum] Schnelle und effektive Vorhersage von microRNA/Zielduplexen roary (3.13.0+dfsg-1) [Universum] Hochgeschwindigkeits-Standalone-Pan-Genom-Pipeline-Rocs (4:19.12.3-0ubuntu1) [Universum] Graphentheorie IDE roguenarok (1.0-3) [Universum] vielseitiger und skalierbarer Algorithmus zur Identifizierung von Rogue Taxon rsem (1.3.3+dfsg-1) [Universum] RNA-Seq durch Erwartungsmaximierung rtax (0.984-6) [Universum] Klassifizierung der Sequenz-Reads des 16S-ribosomalen RNA-Gens ruby-getspg (1.14.1-5build2) [Universum] C-Bibliothek zur Bestimmung der Kristallsymmetrie - Rubinbindungen ruby-rgfa (1.3.1+dfsg-1) [Universum] Parsen, Bearbeiten und Schreiben von Graphen im GFA-Format in Ruby runcircos-gui (0.0+git20180828.97703b9-1build1) [Universum] GUI-Tool zum Ausführen von circos sac2mseed (1.12+ds1-3) [Universum] Konvertieren von SAC-Wellenformdaten in MiniSEED-Saga (7.3.0+dfsg-3build5) [Universum] System für automatisierte geowissenschaftliche Analysen saga-common (7.3.0+dfsg-3build5) [Universum] SAGA GIS architekturunabhängige Dateien saint (2.5.0+dfsg-3) [Universum] Signifikanzanalyse von INTeractome salmid (0.1.23-1) [Universum] schneller Kmer-basierter Salmonella-Identifikator aus Sequenzdaten Lachs (0.12.0+ds1-1) [Universum] unglaublich schnelle Transkriptquantifizierung aus dem RNA-seq-Datensamblaster (0.1.24-2build1) [Universum] markiert Duplikate, extrahiert Diskordanz/Split liest samtools (1.10-3) [Universum] Verarbeitung von Sequenz-Alignments in SAM-, BAM- und CRAM-Formaten samtools-test (1.10-3) [Universum] Testdateien für das Samtools-Paket saods9 (8.1+repack-1) [Universum] Bildanzeigewerkzeug für Astronomie sasview (5.0.1-1build1) [Universum] Small Angle Scattering Analysis Suite sat4j (2.3.5-0.3) [Universum] Effiziente Bibliothek von SAT-Solvern in Java savi (1.5.1-3) [Universum] Visualisierung der Satellitenkonstellation sbmltoolbox (4.1.0-4) [Universum] libsbml-Toolbox für Octave und Matlab Scamp (2.0.4+dfsg-1build2) [Universum] Berechnen astrometrischer und photometrischer Lösungen Science-DistributedComputing (1.12ubuntu1) [Universum] Debian Science Distributed Computing Pakete wissenschaft-elektrophysiologie (1.12ubuntu1) [Universum] Debian Science-Pakete für Elektrophysiologie-Wissenschaft-Hochenergie-Physik (1.12ubuntu1) [Universum] Debian Science High Energy Physics Pakete science-highenergy-physics-dev (1.12ubuntu1) [Universum] Debian Science Hochenergiephysik-Entwicklungspakete Science-Machine-Learning (1.12ubuntu1) [Universum] Debian Science Machine Learning-Pakete science-nanoscale-physics (1.12ubuntu1) [Universum] Debian Science Nanoscale Physics Pakete science-nanoscale-physics-dev (1.12ubuntu1) [Universum] Debian Science Nanoscale Physics Entwicklungspakete science-neuroscience-modeling (1.12ubuntu1) [Universum] Debian Science-Pakete zur Modellierung neuronaler Systeme science-physics-dev (1.12ubuntu1) [Universum] Debian Science Physics-dev Pakete science-psychophysics (1.12ubuntu1) [Universum] Debian Science-Pakete für Psychophysik-Wissenschaftssimulationen (1.12ubuntu1) [Universum] Debian Science Simulation Pakete scoary (1.6.16-2) [Universum] Pangenomweite Assoziationsstudien scram (0.16.2-1build2) [Universum] Probabilistisches Risikoanalysetool scram-gui (0.16.2-1build2) [Universum] SCRAM-GUI-Front-End-Scrm (1.7.3-1build1) [Universum] Simulator der Evolution genetischer Sequenzen sctk (2.4.10-20151007-1312Z+dfsg2-3) [Universum] Spracherkennungs-Scoring-Toolkit Sense (0.994+git20141017.20d3cff-2) [Universum] Bayes-Adapter-Trimmer für die Sequenzierung liest sdaps (1.9.7-0.2ubuntu2) [Universum] Skripte zur Datenerfassung mit papierbasierten Umfragen sdrangelove (0.0.1.20150707-3build2) [Universum] Osmocom Software Defined Radio Seaview (1:4.7-1build2) [Multiversum] Multiplattform-Schnittstelle für Sequenz-Alignment und Phylogeny-Seer (1.1.4-2build2) [Universum] genomisches Sequenzelement (kmer) Anreicherungsanalyse Segemehl (0.3.4-2build1) [Universum] kurzes Lesemapping mit Lücken segyio-bin (1.8.3-1build2) [Universum] SEG-Y-Lese-/Schreibbibliothek für seismische Verarbeitung (Shell-Dienstprogramme) Satzstück (0.1.84-1build1) [Universum] Unüberwachter Text-Tokenizer und Detokenizer seq-gen (1.3.4-2) [Universum] simulieren die Evolution von Nukleotid- oder Aminosäuresequenzen seqmagick (0.8.0-1) [Universum] imagemagick-ähnliches Frontend zu Biopython SeqIO seqprep (1.3.2-5) [Universum] Stripping-Adapter und/oder Zusammenführen von gepaarten Reads von DNA-Sequenzen mit überlappenden seqprep-Daten (1.3.2-5) [Universum] Beispieldatensatz für seqprep - nur zum Testen von seqtk (1.3-1) [Universum] Schnelles und leichtes Tool zur Verarbeitung von Sequenzen im FASTA- oder FASTQ-Format sextractor (2.25.0+ds-2) [Universum] Dummy-Übergangspaket für Namensänderung sga (0.10.15-5build1) [Universum] de novo Genom-Assembler, der String-Graphen verwendet shapeit4 (4.1+dfsg-1build1) [Universum] schnelle und genaue Methode zur Schätzung von Haplotypen (phasing) shelxle (1.0.1062-1) [Universum] grafische Benutzeroberfläche für SHELXL sibsim4 (0.20-4) [Universum] exprimierte RNA-Sequenzen auf einer DNA-Matrizensichel ausrichten (1.33+git20150314.f3d6ae3-1) [Universum] adaptives Trimmen-Tool mit Fenster für FASTQ-Dateien mit Quality Sift (4.0.3b-6) [Multiversum] sagt voraus, ob eine Substitution in einem Protein einen phänotypischen Effekt hat Sigma-Align (1.1.3-6) [Universum] Einfaches gieriges multiples Alignment von nicht-kodierenden DNA-Sequenzen silx (0.12.0+dfsg-1build1) [Universum] Toolbox für Röntgendatenanalyse - Executables sim4 (0.0.20121010-5) [Universum] Tool zum Alignment von cDNA und genomischer DNA simgrid-java (3.24+dfsg-3) [Universum] Java-Bindungen für das SimGrid Toolkit simka (1.5.1-4build1) [Universum] vergleichende Metagenomik-Methode für NGS-Datensätze Simkamin (1.5.1-4build1) [Universum] ungefähre vergleichende metagenomische Methode für NGS-Datensätze siril (0.9.12-2build3) [Universum] astronomisches Bildverarbeitungstool siril-common (0.9.12-2build3) [Universum] architekturunabhängige Dateien für Siril Skesa (2.3.0-2) [Universum] strategische Kmer-Erweiterung für gewissenhafte Montagespieße (0.2.2-1build1) [Universum] Nachbearbeitung der Hochdurchsatz-DNA-Sequenz liest skycat (3.1.2+starlink1 .)

b+dfsg-5build3) [Universum] Bildvisualisierung und Zugriff auf Kataloge und Daten für Astronomie slang-xfig (0.2.0

.117-2) [Universum] Produzieren Sie Plots und Zeichnungen durch Xfig's fig2dev in S-Lang Smalt (0.7.6-9) [Universum] Sequence Mapping und Alignment Tool smalt-examples (0.7.6-9) [Universum] Sequenzzuordnungs- und Ausrichtungswerkzeug (Beispiele) smithwaterman (0.0+git20160702.2610e25-7build1) [Universum] bestimmen ähnliche Regionen zwischen zwei Strings oder genomischen Sequenzen snakemake (5.10.0-2) [Universum] Snapshot des Python-Workflow-Management-Systems (2013-11-29-9) [Universum] Lokalisierung von Genen aus der DNA-Sequenz mit Hidden-Markov-Modell Snap-Aligner (1.0

beta.18+dfsg-3build1) [Universum] Skalierbares Nukleotid-Ausrichtungsprogramm snaphu (2.0.3-1) [Multiversum] Statistical-Cost, Network-Flow-Algorithmus für 2D-Phasen-Unwrapping-Sniffles (1.0.11+ds-1build1) [Universum] Strukturvariationsaufrufer, der snp-Sites der dritten Generation der Sequenzierung verwendet (2.5.1-1) [Universum] Binärcode für das Paket snp-sites snpomatic (1.0-4build1) [Universum] schnelle, stringente Short-Read-Mapping-Software Soapaligner (2.20-3) [Universum] Aligner für kurze Lesevorgänge von Sequenzern der nächsten Generation Soapdenovo (1.05-5) [Universum[Universum[Universum] Resequenzierungsdienstprogramm, das die Konsensussequenz von Genomsolvat (1.0-2) zusammenstellen kann [Multiversum] ordnet Wassermoleküle um Proteinstrukturen solvat-doc (1.0-2) an [Multiversum] Dokumentation für Solvat-Sortmerna (2.1-4build1) [Universum] Tool zum Filtern, Mapping und OTU-Picking NGS liest Source-Extractor (2.25.0+ds-2) [Universum] Quellextraktor für astronomische Bilder mit Abstand (1.2.0-201605+dfsg-1build1) [Universum] Alignment-freier Sequenzvergleich unter Verwendung von Spades (3.13.1+dfsg-2build2) [Universum] Genom-Assembler für Einzelzellen und isoliert Datensätze spaln (2.4.0+dfsg-2build1) [Universum] Splicing-aware Transkript-Alignment zu genomischen DNA-Span-Daten (2.4.0+dfsg-2build1) [Universum] Splicing-aware Transkript-Alignment zu genomischer DNA (Daten) spass (3.7-4) [Universum] automatisierter Theorembeweiser für Logik erster Ordnung mit Gleichheit Spatialite-bin (4.3.0-3build1) [Universum] Geospatial-Erweiterung für SQLite - tools spd (1.3.0-1ubuntu3) [Universum] Synchrotron-Bildkorrekturen und azimutaler Integrationssplash (2.9.1-1ubuntu1) [Universum] Visualisierungstool für Smoothed Particle Hydrodynamics Simulationsspoa (3.0.1-1build1) [Universum] SIMD-Ausrichtungswerkzeug für partielle Ordnung Spread-phy (1.0.7+dfsg-2) [Multiversum] analysieren und visualisieren phylogeographische Rekonstruktionen spview (2.0.0

beta2-2) [Universum] Spectrum Viewer-Squizz (0,99d+dfsg-2) [Universum] Umrechner für genetische Sequenzen und Alignments srst2 (0.2.0-7) [Universum] Kurze Lesesequenz-Typisierung für bakterielle Krankheitserreger ssake (4.0-3) [Universum] Genomikanwendung zum Zusammensetzen von Millionen sehr kurzer DNA-Sequenzen ssake-Beispiele (4.0-3) [Universum] Beispieldaten für SSAKE, einen genomischen Assembler für kurze Lesevorgänge sspace (2.1.1+dfsg-5) [Universum] Gerüst vormontierte Contigs nach Erweiterung ssw-align (1.1-9) [Universum] Smith-Waterman-Aligner basierend auf libssw-Stacks (2.41+dfsg-1build3) [Universum] Pipeline zum Aufbau von Loci aus kurz gelesenen DNA-Sequenzen staden (2.0.0+b11-4build1) [Universum] DNA-Sequenz-Assembly (Gap4/Gap5), Bearbeitungs- und Analysetools staden-common (2.0.0+b11-4build1) [Universum] Architekturunabhängige Dateien für Staden staden-io-lib-examples (1.14.11-6) [Universum] Programme zur Manipulation von DNA-Sequenzierungsdateien (Anwendungsbeispiele) staden-io-lib-utils (1.14.11-6) [Universum] Programme zur Manipulation von DNA-Sequenzierungsdateien stardata-common (0.8build1) [Universum] Gemeinsames Framework zur Verwaltung von Astronomiepaketen startplot (0.95.5-8.3build1) [Universum] 3-dimensionaler perspektivischer Sternkartenbetrachter starpu-contrib-examples (1.3.3+dfsg-1build1) [Multiversum] Taskplaner für heterogene Multicore-Maschinen - exs starpu-examples (1.3.3+dfsg-2build1) [Universum] Taskplaner für heterogene Multicore-Maschinen - exs stellarium (0.19.3-1build1) [Universum] Echtzeit fotorealistischer Himmelsgenerator Stellarium-Daten (0.19.3-1build1) [Universum] Stellarium-Datendateien steif (2.4.0-3) [Universum] Konvertieren von wissenschaftlichen FITS-Bildern in das TIFF-Format Stelzen (3.2-2) [Universum] Starlink Tables Infrastructure Library Tool-Set stimfit (0.16.0-1build2) [Universum] Programm zum Anzeigen und Analysieren elektrophysiologischer Datenreihen (2.1.1+ds-2) [Universum] assemblieren kurze RNAseq-Reads zu Transkripts-Subreads (2.0.0+dfsg-1) [Universum] Toolkit zur Verarbeitung von Next-Gen-Sequenzierungsdaten subread-data (2.0.0+dfsg-1) [Universum] Datendateien für Unterlesepaket Suitename (0.3.070628-2) [Universum] kategorisieren jede Suite in ein RNA-Backbone-Sumaclust (1.0.35-2) [Universum] schnelles und genaues Clustern genomischer Sequenzen sumatra (1.0.31-2) [Universum] schneller und exakter Vergleich und Clustering von Sequenzen Sumo (1.4.0+dfsg1-1) [Universum] Simulation urbaner Mobilität (SUMO) surankco (0.0.r5+dfsg-2) [Universum] Überwachtes Ranking von Contigs in de novo Assemblies Survex (1.2.42-1build2) [Universum] Höhlenvermessungs- und Kartierungssoftware survex-aven (1.2.42-1build2) [Universum] ausgeklügelter Höhlenvermessungs-Viewer für Survex Swarm (3.0.0+dfsg-2build1) [Universum] robuste und schnelle Clustering-Methode für Amplikon-basierte Studien swarp (2.38.0+dfsg-4) [Universum] FITS-Bilder neu berechnen und zusammenfügen swarp виртуальный пакет, предоставляемый suckless-tools swe-basic-data (1.80.00.0002-1ubuntu2) [Universum] Basisdatendateien für das libswe-Paket swe-standard-data (00004-1) [Universum] Standarddaten für das Schweizer Ephemeridenkraut (3.2.1+dfsg-1) [Universum] Bewertung von SNPs hinsichtlich ihrer evolutionären Vorteilssynthese (4.3.0-dfsg1-5) [Universum] Transiente thermische Simulationen in komplexen Festkörpergeometrien syrthes-Tests (4.3.0-dfsg1-5) [Universum] Testfälle für SYRTHES syrthes-tools (4.3.0-dfsg1-5) [Universum] Transiente thermische Simulationen in komplexen Festkörpergeometrien - tools t-coffee (12.00.7fb08c2-4build1) [Universum] Multiple Sequence Alignment t-coffee-Beispiele (12.00.7fb08c2-4build1) [Universum] kommentierte Beispiele für die Verwendung von T-Coffee tabix (1.10.2-3) [Universum] generischer Indexer für TAB-getrennte Genompositionsdateien tandem-mass (1:201702011-1build1) [Universum] Massenspektrometrie-Software zur Proteinidentifikation Tantan (22-1build1) [Universum] geringe Komplexität und Tandem-Repeat-Masker für Biosequenzen tcd-utils (20061127-2build1) [Universum] Konvertieren von Tide Constituent Database (TCD)-Dateien tcl-fitstcl (2.4-4build1) [Universum] Tcl-Schnittstelle zu FITS-Dateien tcliis (8.1+repack-1) [Universum] Tcl IIS Protokollpaket Terraintool (1.13-2) [Universum] Erzeugt Geländemodelle im Survex-Format aus SRTM- und ASTER-Daten therion (5.4.4ds1-5ubuntu1) [Universum] Höhlenvermessung - 2D- und 3D-Zeichensoftware therion-doc (5.4.4ds1-5ubuntu1) [Universum] Dokumentation für Therion Cave Vermessungssoftware therion-viewer (5.4.4ds1-5ubuntu1) [Universum] Höhlenvermessung - 3D-Viewer für Therion-Modelle Theseus (3.3.0-8) [Universum] Makromoleküle überlagern unter Verwendung von Theseus-Beispielen mit maximaler Wahrscheinlichkeit (3.3.0-8) [Universum] überlagern Makromoleküle unter Verwendung von Maximum-Likelihood-Thesen (Beispiele) (3.1.1-1) [Universum] Testen von Haplotyp-Effekten in Assoziationsstudien tigr-glimmer (3.02b-2build1) [Universum] Gennachweis in Archea- und Bakterientimbl (6.4.13-1build1) [Universum] Tilburg Memory Based Learner Timblserver (1.12-1build1) [Universum] Servererweiterungen für Timbl tksao (8.1+repack-1) [Universum] Tk-Widgets für astronomische Bildgebung und Datenvisualisierung tm-align (20190822+dfsg-2build1) [Universum] Strukturelle Ausrichtung von Proteinen tnseq-transit (3.0.2-1build1) [Universum] statistische Berechnungen der Essentialität von Genen oder genomischen Regionen topcat (4.7-2) [Universum] Werkzeug für Operationen an Katalogen und Tabellen Tophat-Recondition (1.4-1) [Universum] Postprozessor für TopHat unmapped liest topp (2.4.0-real-1ubuntu4) [Universum] Reihe von Programmen, die die OpenMS Proteomic Pipeline implementieren, gekrönt (1.10-7) [Universum] Vorhersage der Transmembrantopologie toulbar2 (1.0.0+dfsg3-2build1) [Universum] Exakte kombinatorische Optimierung für grafische Modelle toulbar2-doc (1.0.0+dfsg3-2build1) [Universum] Exakte kombinatorische Optimierung für grafische Modelle - Dokumentation trace2dbest (3.0.1-1) [Universum] Massenübermittlung von Chromatogrammdaten an dbEST trace2dbest-doc (3.0.1-1) [Universum] Dokumentation und Beispieldateien für trace2dbest tracetuner (3.0.6

beta+dfsg-2build1) [Universum] Interpretation der DNA-Sanger-Sequenzierungsdaten transcalc (0,14-6) [Universum] Transdecoder für Mikrowellen- und HF-Übertragungsleitungsrechner (5.0.1-3) [Universum] kodierende Regionen innerhalb von RNA-Transkriptsequenzen finden transrate-tools (1.0.0-2build1) [Universum] Helfer für transrate transtermhp (2.09-4build1) [Universum] finden rho-unabhängige Transkriptionsterminatoren in bakteriellen Genomen travis (190101-1build1) [Universum] Trajektorienanalysator und Visualizer-Baum-Puzzel (5.2-11) [Universum] Parallelisierte Rekonstruktion phylogenetischer Bäume durch Maximum-Likelihood-Baum-Puzzle (5.2-11) [Universum] Rekonstruktion phylogenetischer Bäume durch Maximum-Likelihood-Baum-Puzzle-Doc (5.2-11) [Universum] Rekonstruktion phylogenetischer Bäume nach Maximum Likelihood (doc) Treeview (1.1.6.4+dfsg1-4) [Multiversum] Java-Re-Implementierung von Michael Eisens TreeView treeviewx (0.5.1+git20100823.7e4d0e9-2build1) [Universum] Zeigt und druckt phylogenetische Bäume Triangle-bin (1.6-2build1) [Multiversum] Hochwertige 2-D-Mesh-Generator-Binärprogramme trimmen-galore (0.6.5-1) [Universum] Automatisieren Sie das Qualitäts- und Adaptertrimming für die DNA-Sequenzierung trimmomatic (0.39+dfsg-1) [Universum] flexibles Lese-Trimming-Tool für Illumina NGS-Daten trinityrnaseq (2.6.6+dfsg-6build2) [Universum] RNA-Seq De novo Assembly Trinityrnaseq-Beispiele (2.6.6+dfsg-6build2) [Universum] RNA-Seq De novo Assembly allgemeines Beispiel und Testdateien trnascan-se (2.0.5-1) [Multiversum] Nachweis von Transfer-RNA-Genen in genomischer Sequenz trnascan-se-common (2.0.5-1) [Multiversum] Nachweis von Transfer-RNA-Genen in genomischer Sequenz (gemeinsame Dateien) tunnelx (20170928-2) [Universum] Cave Survey Zeichensoftware tvc (5.0.3+git20151221.80e144e+dfsg-3) [Universum] Genvarianten-Caller für Ion Torrent-Sequenzierungsplattformen twms (0.07z-1) [Universum] winziger Webkartendienst ubertooth (2018.12.R1-4) [Universum] 2,4 GHz drahtlose Entwicklungsplattform für Bluetooth-Experimente Ubertooth-Firmware (2018.12.R1-4) [Universum] Firmware für Ubertooth ubertooth-firmware-source (2018.12.R1-4) [Universum] Quellcode für die Ubertooth-Firmware uc-echo (1.12-13) [Universum] Fehlerkorrekturalgorithmus für kurze Lesevorgänge von NGS ucto (0.14-2build2) [Universum] Unicode Tokenizer uctodata (0.8-2) [Universum] Datendateien für Ucto ugene (34.0+dfsg-1) [Multiversum] integriertes Bioinformatik-Toolkit ugene-data (34.0+dfsg-1) [Multiversum] erforderliche Daten für UGENE - integriertes Bioinformatik-Toolkit uhd-host (3.15.0.0-2build5) [Universum] universeller Hardwaretreiber für Ettus Research Produkte - Host Apps Unicycler (0.4.8+dfsg-2build1) [Universum] Hybrid-Assembly-Pipeline für Bakteriengenome Unicycler-Daten (0.4.8+dfsg-2build1) [Universum] Hybrid Assembly Pipeline für Bakteriengenome (Datenpaket) Units-Filter (3.9-1build1) [Universum] Parser für Ausdrücke zu physikalischen Werten v-sim (3.7.2-8build1) [Universum] Atomare Strukturen visualisieren v-sim-common (3.7.2-8build1) [Universum] Atomare Strukturen visualisieren (Unterstützungsdateien) v-sim-plugins (3.7.2-8build1) [Universum] Plugins für V_Sim (ein 3D-Visualisierungspaket) varna (3-93+ds-2) [Universum] Visualisierungs-Applet für RNA Varscan (2.4.3+dfsg-3) [Multiversum] Variantenerkennung in Sequenzierungsdaten der nächsten Generation vcftools (0.1.16-1build1) [Universum] Sammlung von Tools zum Arbeiten mit VCF-Dateien vdjtools (1.2.1+git20190311-1) [Multiversum] Rahmen für die Nachanalyse von B/T-Zellrepertoires samt (1.2.10+dfsg1-7) [Universum] Nukleinsäuresequenz-Assembler für sehr kurze Reads samt-Beispiel (1.2.10+dfsg1-7) [Universum] Beispieldaten für den Velvet-Sequenz-Assembler samt-long (1.2.10+dfsg1-7) [Universum] Nukleinsäuresequenz-Assembler für sehr kurze Reads, Samt-Tests in langer Version (1.2.10+dfsg1-7) [Universum] Testdaten für den Velvet Sequence Assembler Velvetoptimiser (2.2.6-2) [Universum] Velvet do novo Montageparameter automatisch optimieren veusz (3.0.1-1ubuntu4) [Universum] 2D- und 3D-Anwendung zum wissenschaftlichen Plotten mit grafischer Benutzeroberfläche vg (1.22.0+ds-1) [Universum] Werkzeuge zum Arbeiten mit Genomvariationsgraphen vg-docs (1.22.0+ds-1) [Universum] Werkzeuge zum Arbeiten mit Genomvariationsgraphen -- docs viewmol (2.4.1-26ubuntu1) [Universum] grafisches Frontend für Computerchemieprogramme virulencefinder (2.0.3+git20190809.dde157a-1) [Universum] Virulenzgene in ganz oder teilweise sequenzierten Bakterienisolaten identifizieren Virulencefinder-Beispiele (2.0.3+git20190809.dde157a-1) [Universum] Beispieldaten für Virulencefinder visp-images-data (3.3.0-1) [Universum] Bibliothek für visuelles Servoing - Datensatz-Referenzdateien vistrails (3.0

git+9dc22bd-2) [Universum] Workflow-Toolkit zur wissenschaftlichen Visualisierung vmatch (2.3.1+dfsg-6) [Universum] umfangreiche Sequenzanalysesoftware voro++ (0.4.6+dfsg1-3build1) [Universum] Bibliothek zur Berechnung des Voronoi-Diagramms voro++-Beispiele (0.4.6+dfsg1-3build1) [Universum] Bibliothek zur Berechnung des Voronoi-Diagramms (Beispiele) voronota (1.21.2744-1build1) [Universum] Voronoi-Diagramm-basiertes Tool zum Auffinden von Atomkontakten votca-csg (1.6

rc1-2build1) [Universum] VOTCAs grobkörnige Engine votca-csg-scripts (1.6

rc1-2build1) [Universum] Grobkörnige Skripte von VOTCA votca-csg-tutorials (1.6

rc1-2build1) [Universum] VOTCA's grobkörnige Tutorials votca-tools (1.6

rc1-3build1) [Universum] VOTCA-Tools-Bibliothek, Hilfs-Binärdateien vowpal-wabbit (8.6.1.dfsg1-1build2) [Universum] schneller und skalierbarer Online-Algorithmus für maschinelles Lernen vrrender (19.0.0-5ubuntu4) [Universum] DICOM-Viewer vsearch (2.14.1-3build1) [Universum] Werkzeug zum Verarbeiten metagenomischer Sequenzen wannier90 (3.0.0+ds-4build1) [Universum] Maximal lokalisierte Wannier-Funktionen - ausführbare Dateien wannier90-data (3.0.0+ds-4build1) [Universum] Maximal lokalisierte Wannier-Funktionen - Dokumentation und Beispiele wcslib-tools (7.1+ds-2) [Universum] Befehlszeilentools, die wcslib verwenden wcstools (3.9.5-3) [Universum] Behandeln des WCS eines FITS Image Weightwatcher (1.12+dfsg-1) [Universum] Kombinieren von Karten und Polygondaten für die astronomische Bildverarbeitung weka (3.6.14-1) [Universum] Machine-Learning-Algorithmen für Data-Mining-Aufgaben wham-align (0.1.5-2build1) [Universum] Wisconsin's High-Throughput Alignment Method wigeon (20101212+dfsg1-3) [Universum] Neuimplementierung des Pintail 16S DNA-Anomalie-Erkennungsprogramms (2.4.1-21) [Universum] Vergleich von Biopolymeren, wie DNA- und Proteinsequenzen wsclean (2.8-1build2) [Universum] Schneller generischer interferometrischer Weitfeld-Imager wxastrocapture (1.8.1+git20140821.796e1a1+dfsg-1) [Universum] Windows linuX Astronomy Capture x13as (1.1-B39-1build1) [Multiversum] Saisonbereinigungssoftware zur Modellierung von Zeitreihen xbs (0-10build1) [Universum] 3D-Modelle und Filme von Molekülen xcas (1.5.0.85+dfsg1-3) [Universum] Computer Algebra System - Konsole und Grafikrechner xcrysden (1.6.2-3build1) [Universum] Kristalline und molekulare Struktur Visualizer xcrysden-data (1.6.2-3build1) [Universum] Kristalline und molekulare Strukturvisualisierung (Datendateien) xdrawchem (1:1.10.2.1-3build1) [Universum] Editor für chemische Strukturen und Reaktionen xfoil (6.99.dfsg+1-1build1) [Universum] Programm zur Auslegung und Analyse von Unterschallprofilen xmakemol (5.16-9) [Universum] Programm zur Visualisierung atomarer und molekularer Systeme xmakemol-gl (5.16-9) [Universum] Programm zur Visualisierung atomarer und molekularer Systeme (OpenGL) xpa-tools (2.1.19-1) [Universum] Tools für die nahtlose Kommunikation zwischen Unix-Programmen xplot (1.19-9build2) [Universum] einfacher x-y-Säulen-Datenplotter auf dem Bildschirm xplot-xplot.org (0.90.7.1-4) [Universum] schnelles Tool zur grafischen Darstellung und Visualisierung vieler Daten xppaut (6.11b+1.dfsg-1build1) [Universum] Phase Plane Plus Auto: Löst viele Arten von Gleichungen xtide (2.13.2-1build2) [Universum] liefert Gezeiten- und Strömungsvorhersagen xtide-coastline (20020202-1) [Universum] Küstenliniendaten für xtide xtide-data (20100529-1) [Universum] Oberwellendaten für xtide xtide-data-nonfree (20100529-1) [Multiversum] Harmonische Daten für xtide (Kanada, Niederlande, Deutschland und UK) xyscan (4.30-2build2) [Universum] Datendieb für Wissenschaftler yade (2020.01a-6build2) [Universum] Plattform für die diskrete Elementmodellierung yagv (0,4

20171211.r234ef16+dfsg-1) [Universum] noch ein weiterer G-Code-Viewer yaha (0.1.83-1build1) [Universum] Split-Read-Zuordnungen für Single-End-Abfragen finden yorick-av (0.0.5-1build1) [Universum] Filme von Yorick in verschiedenen Formaten schreiben yorick-full (2.2.04+dfsg1+full) [Universum] vollständige Installation des Yorick-Interpreters und der Add-Ons yorick-gy (0.0.5-1) [Universum] GObject-Introspektion und Gtk-Bindungen für Yorick yorick-gyoto (1.4.4-3) [Universum] Allgemeine relativistische geodätische Integration für die Yorick-Sprache yorick-mira (1.1.0+git20170124.3bd1c3

dfsg1-2) [Universum] optische Interferometrie-Bildrekonstruktion in Yorick yorick-mpeg (0,1-3) [Universum] MPEG-Ausgabeunterstützung für die Yorick-Sprache yorick-mpy-common (2.2.04+dfsg1-10) [Universum] Nachricht übergibt Yorick (allgemeine Dateien) yorick-mpy-mpich2 (2.2.04+dfsg1-10) [Universum] Message Passing Yorick (MPICH2 build) yorick-mpy-openmpi (2.2.04+dfsg1-10) [Universum] Message Passing Yorick (OpenMPI build) yorick-svipc (0.16-5build1) [Universum] Interprozesskommunikation (Shared Memory. ) für Yorick yorick-ygsl (1.2.1-1build1) [Universum] GSL-Spezialfunktionen-Plugin für die Yorick-Sprache yorick-ynfft (1.0.3-1) [Universum] schnelle Fourier-Transformation ohne gleichen Abstand für Yorick z3 (4.8.7-4build1) [Universum] Theorembeweiser von Microsoft Research z88 (13.0.0+dfsg2-6) [Universum] Finite-Elemente-Analyseprogramm - Laufzeit zalign (0.9.1-4build1) [Universum] paralleles lokales Alignment biologischer Sequenzen zegrapher (3.0.2-1build1) [Universum] Zeichnen mathematischer Funktionen und Folgen auf der Ebene zimpl (3.3.6-2) [Universum] mathematische Modellierungssprache für Optimierungsprobleme ztex-bmp (20120314-2) [Universum] universeller Makroprozessor


Williams T, Kelley C, Bröker HB, Campbell J, Cunningham R, Denholm D, Elber G, Fearick R, Grammes C, Hart L, Hecking L, Koenig T, Kotz D, Kubaitis E, Lang R, Lecomte T, Lehmann A , Mai A, Merritt EA, Mikulík P, Steger C, Tkacik T, Van der Woude, Woo A, Van Zandt JR, Zellner J: Gnuplot. [http://www.gnuplot.info/].

Mathworks:Matlab: Die Sprache des technischen Rechnens. [http://www.mathworks.com/products/matlab/].

Abbott B, Adler A, Aitkenhead AH, Anderson G, Andersson J, Annamalai M, Appel M, Atzeri M, Ayal S, Banks R, Barrowes B, Barth A, Bateman D, Bauschke H, Bect J, Belov R, Berry K , Billinghurst D, Bindner D, Bogusz J, Borgmann M, Boven P, Bovey R, Bradshaw J, Brinkmann M, Brister M, Bruno R, Buchacher C, Burchard A, Caliari M:GNU Octave. [http://www.gnu.org/software/octave].

Harrington B, Hurst N, Gould T, Albert M, Andler J, Bah T, Barbry-Blot P, Barraud JF, Baxter B, Beard J, Bintz J, Biro A, Bishop N, Blocher JL, Böck H, Bohre H, Borgmann D, Bouclet B, Broberg G, Brown C, Breuer H, Brubaker M, Bruno L, Buculei N, Byak B, Caclin P, Caldwell I, Carmichael G, Catmur E, Boldewyn:Inkscape. [http://inkscape.org].

Dantzig GB: Maximierung einer linearen Funktion von Variablen, die linearen Ungleichungen unterliegen. Aktivitätsanalyse der Produktion und Allokation. Bearbeitet von: Koopmans TC. 1951, New York und London: Wiley und Chapman-Hall, 339-347.

Stroustrup B: Die C++-Programmierung, Sprache, 4. Aufl. 2013, Upper Saddle River: Addison-Wesley Professional

Doumont J-L: Bäume, Karten und Theoreme: Effektive Kommunikation für rationale Köpfe. 2009, Kraainem: Principiae

Tufte ER: The Visual, Display of Quantitative Information, 2. Aufl. 2001, Cheshire: Grafikpresse


Schau das Video: Multiple sequence alignment with clustalw and boxshade (August 2022).