Information

18.5: Wege des Aminosäureabbaus – Biologie

18.5: Wege des Aminosäureabbaus – Biologie


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Die Wege des Aminosäureabbaus

In den vorherigen Abschnitten haben wir gesehen, wie Stickstoff aus Aminosäuren entfernt wird, um Harnstoff oder NH . zu produzieren4+, dass einige Aminosäuren glucogen, ketogen oder beides sind, und die Rolle von Tetrahydrofolat-Derivaten und S-Adenosylmethion in 1C-Transferreaktionen. Jetzt können wir uns darauf konzentrieren, wie die Kohlenstoffgerüste von Aminosäuren beim Abbau verarbeitet werden.

Hier sind einige Hauptmerkmale des Aminosäurekatabolismus, die im vorherigen Abschnitt besprochen wurden. .

  • einige werden zu Pyruvat, dem Endprodukt der Glykolyse und dem Startreaktanten der Gluconeogenese, umgewandelt. Daher sind diese Aminosäuren glukogen;
  • einige werden in Acetoacetat-CoA und/oder Acetyl-CoA umgewandelt. Beide können in Ketonkörper (Acetoacetat/β-Hydroxybutyrat) umgewandelt werden, sodass diese berücksichtigt werden ketogen. Da die beiden Kohlenstoffe der Acetylgruppe von Acetyl-CoA als CO . verloren gehen2 im TCA-Zyklus, und es gibt keine Umkehrung für die Pyruvat-Dehydrogenase-Reaktion (pyr → Acetyl-CoA), kann Acetyl-CoA, das durch Aminosäureabbau gebildet wird, nicht verwendet werden, um Glukose in Nettoform zu erzeugen;
  • einige werden metabolisiert, um TCA-Zwischenprodukte zu bilden. Da sie in hinzugefügt werden Netz Mode zum TCA-Zyklus und entfernen Sie nicht den vorhandenen Pool an TCA-Zwischenprodukten, sie können in Netz direkt oder indirekt Moleküle herstellen, die zur Herstellung von Glukose verwendet werden können. Diese Eintrittsreaktionen in das TCA, die TCA-Zwischenprodukte auffüllen oder hinzufügen, werden anerplerotische (ergänzende) Reaktionen genannt. Daher sind diese Aminosäuren auch glukogen.
  • einige haben mehrere Möglichkeiten, abgebaut zu werden und können sowohl Acetyl-CoA als auch Pyruvat produzieren, also sind sie sowohl glucogneisch als auch ketogen.

Lassen Sie uns expliziter werden:

  • rein ketogen: nur Leu und Lys (die einzigen Aminosäuren, deren Name mit beginnt L und du musst LIch liebe sie, da es in dieser Kategorie nur 2 Aminosäuren gibt)
  • beide: 5 enthalten die Aromaten - Trp, Tyr, Phe - und Ile/Thr
  • rein glucogen: der Rest

Die folgende Abbildung, die auch in den vorherigen Abschnitten gezeigt wurde, fasst die Schicksale der 20 Aminosäuren in ihren katabolen Reaktionen zusammen

Umwandlung in Pyruvat: Ala, Trp, Cys, Ser, Gly, Thr

Wir haben Abschnitt 18:3 über die Diskussion über den Ser Gly One Carbon Cycle (SGOC) beendet, daher wird einiges davon ein kleiner Rückblick sein.

Hier eine Übersicht der Reaktionen. Weitere Details werden für jeden der folgenden Schritte bereitgestellt.

Die metabolischen Schritte für die in den Schritten A-F gezeigten chemischen Umwandlungen werden unten detaillierter beschrieben.

A. Tryptophan zu Alanin

Dies ist ein mehrstufiger Prozess. Das Ausgangsmaterial Tryptophan ist in einem roten Kästchen hervorgehoben, während das Endprodukt von besonderem Interesse, Ala, in einem grünen Kästchen hervorgehoben ist. Keine Reaktion findet in einer Zelle isoliert statt, sondern als Teil eines komplexeren Weges. In der Abbildung unten ist Ala fast als Nebenprodukt dargestellt, da der modifizierte aromatische Ring, der entweder in Anthranilat oder 3-Hydroxyanthranilat gefunden wird, weiterhin entweder Acetoacetat bildet, einen Ketonkörper, der zu Acetyl-CoA zerfallen kann (wodurch Trptophan sowohl ketogen als auch ketogen wird). glucogen) oder NAD+.

B. Alanin zu Pyruvat

Wie in 18.2 beschrieben, ist das PLP-abhängige Enzym ALAnin Amino Transferase (ALT), auch bekannt als glutamat Pyruvat TRansaminase (GPT), katalysiert diese einfache Transaminierungsreaktion:

Alanin +α−Ketoglutarat ↔ Pyruvat + Glutamat

Das bei dieser Reaktion entstehende Glutamat kann oxidativ zu NH . desaminiert werden4+ und alpha-Ketogluatarat wieder, was die Nettoreaktion ergibt:

Ala + NAD(P)+ + H2O ↔ Pyr + + NAD(P)H + NH4+

C. Threonin zu Glycin

Es gibt mehrere Wege für diese Umwandlung.

Einer beinhaltet die Umwandlung von Thr zu 2-Amino-3-ketobutyrat durch Threonin-3-Dehydrogenase.

Rx: Thr + NAD+ ↔ 2-Amino-3-ketobutyrat + NADH

Danach erfolgt die Umwandlung von 2-Amino-3-ketobutyrat in Glycin durch das Enzym 2-Amino-3-ketobutyrat-Coenzym-A-Ligase.

Rx: 2-Amino-3-ketobutyrat + CoASH ↔ Gly + Acetyl-CoA

Das Netz dieser Reaktionen ist

Rx: Thr + NAD+ + CoASH ↔ Gly + Acetyl-CoA + NADH

EIN Sekunde und die vorherrschende Reaktion beinhaltet die Umwandlung von Thr in NH4 + und α-Ketobutyrat durch das PLP-abhängige Enzym Ser/Thr-Dehydratase (auch Threonin-Ammoniak-Lyase genannt), ein Enzym, das wir im vorherigen Abschnitt gesehen haben. Beachten Sie, dass diese Reaktion NICHT produzieren Glycin, ist aber ein i.

Rx: Thr ↔ NH4 + + α-Ketobutyrat

α-Ketobutyrat kann dann in Proprionyl-CoA umgewandelt werden.

Rx: α-Ketobutyrat + NAD+ + CoASH ↔ Proprionyl-CoA + NADH + CO2 + H+

Diese Reaktion, katalysiert durch die innere Mitochondrienmembran verzweigte Kette Der α-Ketosäure-Dehydrogenase-Komplex (BCKDC- oder BCKDH-Komplex) ist eine oxidative Decarboxylierungsreaktion. BCKDC ist ein Mitglied von zwei anderen Enzymen, Pyruvat-Dehydrogenase und Alpha-Ketoglutarat-Dehydrogenase, die beide auf kurze Alpha-Ketosäuren wirken, um wichtige Metaboliten des Kreb-Zyklus zu produzieren.

Proprionyl-CoA wird dann schließlich in mehreren mitochondrialen Schritten zu Succinyl-CoA für den Eintritt in den TCA-Zyklus umgewandelt. Für diese Umwandlung werden drei Enzyme benötigt: Proprionyl-CoA-Carboxylase, Methylmalonyl-CoA-Epimerase und Methylmalonyl-CoA-Mutase. Proprionyl-Carboxylase benötigt wie eine andere Alpha-Ketosäure-Carboxylase (Pyruvat-Carboxylase) EINTP, BJotin und CÖ2 (als Substrat) für die Carboxylierungsreaktion und wird daher oft als ein . bezeichnet ABC Enzym.

Der dreistufige Umwandlungsweg von Proprionyl-CoA zu Succinyl-CoA wird auch beim Abbau von Veine Linie, Ödd-kettige Fettsäuren (die mehrere 2-Kohlenstoff-Acetyl-CoA-Einheiten und 1 3-C-Proprionyl-CoA-Einheit bilden), mEthionin und ichSoleucin zusammen mit Threonin. Dieser dreistufige Weg wird manchmal als VOMIT-Weg bezeichnet.

Der dritte Weg, den wir gerade im vorherigen Abschnitt gesehen haben, wird durch Serinhydroxymethyltransferase (SHMT) (aber auch Glycinhydroxymethyltransferase oder Threoninaldolase genannt) katalysiert und erfordert die Verwendung von PLP und Tetrahydrofolat als Cofaktoren. Ein 1C Methylen wird zu Tetrahydrofolat (FH4). PLP bildet Bindungen zum Alpha-Kohlenstoff von Aminosäuren, die spaltungslabil sind. In diesem Fall wird die Aminosäure Threonin durch eine Alpha-Eliminationsreaktion dehydriert. Threonin hat jedoch ein zusätzliches CH3 Gruppe, die als Acetaldehyd freigesetzt wird. Hier die Gesamtreaktion.

Rx: Thr+ FH4 + ↔ Glycin + N5,N10-FH4 + Acetaldehyd + H2Ö

Die an dieser Reaktion beteiligten Enzyme sind in der Literatur etwas unklar. Es scheint, dass SHMT mit geringerer Geschwindigkeit auf Thr einwirken kann, aber dass ein zweites Enzym, die Threonin-Aldolase, die bei Säugetieren nicht funktionsfähig zu sein scheint, in anderen Organismen wirkt.

D. Glycin zu Serin

Wie oben erwähnt, wird diese reversible Reaktion durch Serinhydroxymethyltransferase (SHMT) katalysiert (siehe Mechanismus in Abschnitt 18.4) und verwendet Tetrahydrofolat und PLP als Cofaktoren. Hier ist die Gesamtreaktion, die Umkehrung von Gly ↔ Ser, die wir in 18.4 gesehen haben.

Rx: Glycin + N5,N10-CH2-FH4 + H2O ↔ Serin + FH4

Abbildung A unten zeigt die Dehydratisierungsreaktion und die Bildung von Glycin. mit PLP als Cofaktor. Abbildung B zeigt, wie das freigesetzte Formaldehyd mit FH . reagiert4 N . bilden5, N10-Methylen FH4, mit FH4 als Cofaktor

E. Serin zu Pyruvat

Diese Reaktion ist analog zur Ala → Pyr-Reaktion in Rx B oben und wird durch das PLP-abhängige Enzym Serin/Threonin-Dehydratase/Threonin-Deaminase katalysiert.

Rx: Serin ↔ Pyr + NH4+

Das Enzym kommt im Zytoplasma vor und ist hauptsächlich an der Gluconeogenese beteiligt.

F. Cystein zu Pyruvat

Die Gesamtreaktionen für diese Umwandlung sind in der folgenden Abbildung dargestellt. Die zur Herstellung von 3-Sulfinylpyruvat verwendete Aspartat-Aminotransferase ist zytosolisch und nicht die gleiche wie die häufiger vorkommende Version in den Mitochondrien.

INTRO HINZUFÜGEN

Andere wichtige Metaboliten werden aus Cystein-Katabolisierungswegen hergestellt. Eines ist Taurin, das tatsächlich am häufigsten vorkommt kostenlos Aminosäure im Körper und ist besonders reichlich in der Entwicklung und in der frühen Milch vorhanden. Es wird überwiegend in der Leber synthetisiert. Es ist unklar, ob Hypotaurin auf nicht-enzymatische Weise oder durch eine Oxidase/Dehydrogenase in Taurin umgewandelt wird.

Das in den Stoffwechselwegen produzierte Sulfat wird verwendet, um ein interessantes Derivat von ATP, 3'-Phosphoadenosin-5'-phosphosulfat (PAPS), herzustellen, das zur Herstellung von sulfatierten Zuckern in der Glykolipid- und Proteoglykan-Synthese verwendet wird.

Umwandlung in Acetyl-CoA: Trp, Lys, Phe, Tyr, Leu, Ile, Thr

Eine Übersicht über die vielen Reaktionen beim ketogenen Aminosäureabbau ist in der folgenden Folie dargestellt. Die rot eingerahmten Aminosäuren sind diejenigen, die entweder Acetoacetat (einen Ketonkörper) oder direkt Acetyl-CoA (grüne Kästchen) bilden. Einige der Kohlen sind rot oder grün farbcodiert, um anzuzeigen, wo sie landen.

A. Trp zu Acetyl-CoA

Glücklicherweise haben wir die Umwandlung von Nicht-Ring-Teilen von Tryptophan in Alanin und in eine Vorstufe von Acetoacetyl-Coa (2-Amino-3-carboxymuconat-6-semialdehyd - ACMS) und in NAD . untersucht+ (Chinolinat). ACMS führt durch die Wirkung von ACMS-Decarboxylase zu Acetoacetyl-CoA und dann zu Acetyl-CoA, wie unten gezeigt zu detailliert.

B. Lys-Stoffwechsel

„Hier gibt es mehrere, mindestens drei Wege für den Lysin-Katabolismus, aber der primäre Weg, der in der Leber genutzt wird, ist einer, der mit der Bildung eines Addukts zwischen Lysin und 2-Oxoglutarat (α-Ketoglutarat) namens Saccharopin beginnt die Art und Weise, wie die ε-Aminogruppe auf 2-Oxoglutarat und in den allgemeinen Stickstoffpool übertragen wird Die Reaktion ist eine Transaminierung, bei der die ε-Aminogruppe auf den α-Keto-Kohlenstoff von 2-Oxoglutarat übertragen wird, wodurch der Metabolit Saccharopin entsteht Im Gegensatz zu den meisten Transaminierungsreaktionen wird bei dieser Reaktion kein Pyridoxalphosphat als Cofaktor eingesetzt.Die Bildung von Saccharopin und seine Hydrolyse zu α-Aminoadipin-6-semialdehyd wird durch das bifunktionelle Enzym α-Aminoadipin-Semialdehyd-Synthase katalysiert der Aminostickstoff verbleibt mit dem α-Kohlenstoff von 2-Oxoglutarat, wodurch Glutamat und α-Aminoadipin-6-semialdehyd gebildet werden Da diese Transaminierungsreaktion nicht reversibel ist, ist Lysin s eine essentielle Aminosäure. Die α-Aminoadipinsäure-Semialdehyd-Synthase von Säugetieren wird vom AASS-Gen auf Chromosom 7q31.32 kodiert und besteht aus 25 Exons, die ein mitochondrial lokalisiertes Protein von 926 Aminosäuren kodieren. Die N-terminale Hälfte des AASS-Proteins beherbergt die Lysin:2-Oxoglutarat-Reduktase-Aktivität und die C-terminale Hälfte beherbergt die Saccharopin-Dehydrogenase-Aktivität. Das ultimative Endprodukt des Lysin-Katabolismus über diesen Saccharopin-Weg ist Acetoacetyl-CoA."

"Lysin-Oxoglutarat-Reduktase (LOR)/
Saccharopin-Dehydrogenase (SDH), die sich auf einem einzelnen bifunktionellen Polypeptid (LOR/SDH) befindet

CD. Umwandlung von Phenylalanin in Tyrosin und weiterhin in Acetoacetat

Wir werden die Umwandlung von Phenylalanin in Tyrosin verfolgen, das weiter zu Acetoacetat wird, wodurch Phe und Tyr zu ketogenen Aminosäuren werden und in den nachfolgenden Schritten Fumarat produziert wird. Die Dose tritt in den TCA-Zyklus ein, was zur Nettoproduktion von Oxalacetat führt, das in die Gluconeogenese gezogen werden kann, wodurch sowohl Phe als auch Try glucogen werden.

Darüber hinaus werden wir die Chemie eines weiteren Cofaktors untersuchen, der den Elektronenfluss bei der Umwandlung von Phe zu Try im ersten Schritt erleichtert, katalysiert durch das Enzym Tyrosinhydroxlase. Dieser Cofaktor ist Tetrahydrobiopterin (BH4).

Online veröffentlicht am 29. Januar 2013. doi: 10.1021/bi301675e

PMCID: PMC3572726

NIHMSID: NIHMS438181

PMID: 23327364

Kenneth M. Roberts, Jorge Alex Pavon,§ und Paul F. Fitzpatrick*

Ein möglicher Mechanismus ist unten gezeigt.

"1) Oxidation des Pterin-Cofaktors zur Bildung des reaktiven hydroxylierenden Zwischenprodukts, gefolgt von 2) Insertion von Sauerstoff in das Aminosäuresubstrat (20). Diese Ansicht wird durch die Beobachtung gestützt, dass die Pterinoxidation von der Aminosäureoxidation entkoppelt werden kann, entweder wenn unphysiologische Aminosäuren werden als Substrate (11, 25) oder in einer Vielzahl von TyrH-Mutanten im aktiven Zentrum verwendet.

Wie bei der Umwandlung von Dihydrofolat zurück in Tetrahydrofolat (FH4) durch Dihydrofolat-Reduktase wird das 4a-OH-BH4 zu Dihydrobiopterin und dann zu Tetrahydrobiopterin durch Dihyrobiopterin-Reduktase umgewandelt.

Hier ist der vollständige Weg für die Umwandlung von Phe und Tyr zu Acetoacetat und Fumarat

Henylalanin hat normalerweise nur zwei Schicksale: den Einbau in Polypeptidketten und die Hydroxylierung zu Tyrosin über die Tetrahydrobiopterin-benötigende Phenylalanin-Hydroxylase (PAH)-Reaktion. Somit erfolgt der Phenylalanin-Katabolismus immer auf dem Weg der Tyrosin-Biosynthese, gefolgt vom Tyrosin-Katabolismus. Tyrosin ist gleichermaßen wichtig für die Proteinbiosynthese sowie ein Zwischenprodukt in der Biosynthese der Katecholamine: Dopamin, Noradrenalin und Epinephrin (siehe Aminosäurederivate).

Der Abbauweg von Tyrosin beinhaltet die Umwandlung in Fumarat und Acetoacetat, wodurch Phenylalanin und Tyrosin sowohl als glucogen als auch ketogen klassifiziert werden können. Der Katabolismus von Tyrosin umfasst fünf Reaktionen, von denen vier nachweislich mit angeborenen Stoffwechselstörungen verbunden sind und drei davon zu klinisch signifikanten Störungen führen. Die erste Reaktion des Tyrosinkatabolismus umfasst das im Kerngenom kodierte mitochondriale Enzym Tyrosinaminotransferase und erzeugt die entsprechende Ketosäure, P-Hydroxyphenylbrenztraubensäure.

Wie die meisten Aminotransferase-Reaktionen verwendet die Tyrosinaminotransferase 2-Oxoglutarat (α-Ketoglutarat) als Aminoakzeptor mit der nachfolgenden Bildung von Glutamat. Tyrosin-Aminotransferase wird vom TAT-Gen auf Chromosom 16q22.2 kodiert, das aus 12 Exons besteht, die ein Protein mit 454 Aminosäuren erzeugen. Die zweite Reaktion des Tyrosinkatabolismus wird durch 4-Hydroxyphenylpyruvat-Dioxygenase katalysiert, die vom HPD-Gen auf Chromosom 12q24.31 kodiert wird, das aus 17 Exons besteht, die zwei alternativ gespleißte mRNAs erzeugen, die für Proteine ​​mit 393 Aminosäuren (Isoform 1) und 354 . kodieren Aminosäuren (Isoform 2).

Das Produkt der HPD-Reaktion ist Homogentisinsäure (Homogentisat). Homogentisat wird durch das zweite Dioxygenase-Enzym des Tyrosin-Katabolismus, Homogentisat-Oxidase, oxidiert. Homogentisat-Oxidase wird durch das Homogentisat-1,2-Dioxygenase-Gen, HGD, kodiert. Das HGD-Gen befindet sich auf Chromosom 3q13.33 und besteht aus 16 Exons, die ein Protein von 445 Aminosäuren kodieren.

Die Oxidation von Homogentisat ergibt 4-Maleylacetoacetat, das durch das Enzym Glutathion-S-Transferase Zeta (ζ) 1, das vom GSTZ1-Gen kodiert wird, zu 4-Fumarylacetoacetat isomerisiert wird. Glutathion-S-Transferase Zeta 1 wurde früher 4-Maleylacetoacetat-Isomerase oder Maleylacetoacetat genannt cistrans-Isomerase. Das GSTZ1-Gen befindet sich auf Chromosom 14q24.3 und besteht aus 9 Exons, die vier alternativ gespleißte mRNAs erzeugen, von denen jede für eine bestimmte Proteinisoform kodiert.

Fumarylacetoacetat wird durch das Enzym Fumarylacetoacetat-Hydrolase, das vom FAH-Gen auf Chromosom 15q25.1 kodiert wird und aus 15 Exons besteht, die ein Protein mit 419 Aminosäuren bilden, zu Fumarat und Acetoacetat hydrolysiert.

Das Fumarat-Endprodukt des Tyrosin-Katabolismus wird direkt in den TCA-Zyklus zur weiteren Oxidation eingespeist. Das Acetoacetat wird durch die Wirkung des mitochondrialen Ketonkörperverwertungsenzyms Succinyl-CoA:3-Oxosäure-CoA-Transferase (SCOT), das vom OXCT1-(3-Oxosäure-CoA-Transferase 1)-Gen kodiert wird, zu Acetoacetyl-CoA aktiviert. Acetoacetat kann auch im Zytosol durch das zytosolische Enzym Acetoacetyl-CoA-Synthetase (AACS) aktiviert werden."

E. Leu zu Acetoacetat

dkfjdkjf

„Der erste Schritt ist jeweils eine Transaminierung mit einer Pyridoxalphosphat-abhängigen BCAA-Aminotransferase (bezeichnet als verzweigtkettige Aminotransferase, BCAT) mit 2-Oxoglutarat (α-Ketoglutarat) als Aminakzeptor.“

F. Isoleucin zu Acetyl-CoA

kdjkdjfkjd

Umwandlung in α-Ketoglutarat: Pro, Glu, Gln, Arg,His

A. Prolin und Arginin

Aldehyd-Dehydrogenase-4-Familie, Mitglied A1 (ALDH4A1) oder D1-Pyrrolin-5-Carboxylat-Dehydrogenase, (P5CDH)

"Lutamat, das aus dem Ornithin- und Prolin-Katabolismus entsteht, kann dann in einer Transaminierungsreaktion in 2-Oxoglutarat (α-Ketoglutarat) umgewandelt werden. Daher sind Ornithin und Prolin beide glucogen. Da Arginin zu Harnstoff und Ornithin metabolisiert wird und das resultierende Ornithin eine glucogene Vorstufe ist, ist Arginin auch eine glucogene Aminosäure."

Der Gesamtpfad ist unten gezeigt

B. Histidin

dfdfd

dfd

C. Glutamin und Glutaminsäure

Wie in den obigen Reaktionen beschrieben, kann es durch Transaminierungsreaktionen in α-Ketoglutarat umgewandelt werden. Wie in Abschnitt 18.x beschrieben, kann Gluatamin durch die Wirkung von Glutaminase desaminiert werden, um Glutamin zu bilden, das ebenfalls α-Ketoglutarat, ein glukoneogenes Zwischenprodukt, bilden kann.

Umwandlung in Succinyl-CoA: Met, Ile, Thr, Val

Wir haben gerade gesehen, dass zwei verzweigtkettige Aminosäuren, Leu und Ile, in Acetyl-CoA umgewandelt werden und daher ketogen sind (E und F oben). Eine andere verzweigtkettige hydrophobe Aminosäure, Val, und auch wiederum Leu, können in Succinyl-CoA umgewandelt werden, das im Kreb-Zyklus in Netto-Weise in α-Ketoglutarat umgewandelt werden kann und somit glucogene Aminosäuren sind. Wir haben in der Einführung zu Aminosäuren, die Acetyl-CoA produzieren, gesehen, dass Threonin und Isoleucin, zwei verzweigtkettige Aminosäuren, auch Proprionyl-CoA bilden, das zu Succinyl-CoA übergeht. Betrachten wir also Val, eine weitere verzweigtkettige Aminosäure, bevor wir Met betrachten, die beide 3 Cs in ihren Seitenketten haben.

Val

sdsdf

Methionin

Die Hauptschicksale der essentiellen Aminosäure Methionin sind der Einbau in Polypeptidketten und die Verwendung bei der Produktion von Cystein und &agr;-Ketobutyrat über den Reaktionsweg, der die Synthese von SAM und Cystein, wie oben beschrieben, beinhaltet. Die Transsulfurierungsreaktionen, die Cystein aus Homocystein und Serin produzieren, produzieren auch α-Ketobutyrat, wobei letzteres zuerst zu Propionyl-CoA und dann über einen 3-Stufen-Prozess zu Succinyl-CoA umgewandelt wird.

Beim Katabolismus von Methionin wird das α-Ketobutyrat in Propionyl-CoA umgewandelt. Das Propionyl-CoA wird über einen mitochondrial lokalisierten Drei-Reaktions-ATP-abhängigen Weg in Succinyl-CoA umgewandelt. Das Succinyl-CoA kann dann zur weiteren Oxidation in den TCA-Zyklus eintreten. Die für diese Umwandlung erforderlichen Enzyme sind Propionyl-CoA-Carboxylase, Methylmalonyl-CoA-Epimerase bzw. Methylmalonyl-CoA-Mutase.Propionyl-CoA-Carboxylase wird aufgrund der Anforderungen an ABC-Enzym genannt EINTP, BJotin, und CÖ2 für die Reaktion. Die klinische Bedeutung der Methylmalonyl-CoA-Mutase in diesem Stoffwechselweg besteht darin, dass sie als eines von nur zwei Enzymen ein Vitamin B . benötigt12-abgeleiteter Co-Faktor für Aktivität. Das andere B12-erforderndes Enzym ist Methioninsynthase (siehe Abschnitt Cysteinsynthese oben). Dieser Propionyl-CoA-Umwandlungsweg wird auch für den Stoffwechsel der Aminosäuren Valin, Isoleucin und Threonin und Fettsäuren mit ungerader Kohlenstoffatomzahl benötigt. Aus diesem Grund wird dieser dreistufige Reaktionsweg von der Gedächtnisstütze oft als VOMIT-Weg bezeichnet, wobei V steht für Valin, Ö für ungeradkettige Fettsäuren, m für Methionin, ich für Isoleucin und T für Threonin

oben von med chem

unten von smpdb

Der Methioninstoffwechsel bei Säugetieren erfolgt auf zwei Wegen, einem Methioninzyklus und einer Transsulfurierungssequenz. Diese Wege haben drei gemeinsame Reaktionen mit beiden Wegen, einschließlich der Umwandlung von Methionin in S-Adenosylmethionin (SAM), der Verwendung von SAM in vielen verschiedenen Transmethylierungsreaktionen, die zu einem methylierten Produkt plus S-Adenosylhomocystein führen, und der Umwandlung von S-Adenosylhomocystein zu die Verbindungen Homocystein und Adenosin. Die oben genannten Reaktionen produzieren nicht nur Cystein, sondern auch a-Ketobutyrat. Diese Verbindung wird dann in einem dreistufigen Verfahren in Succinyl-CoA umgewandelt, nachdem sie in Propionyl-CoA umgewandelt wurde. Wenn die Aminosäuren Cystein und Methionin in ausreichender Menge verfügbar sind, wird der Stoffwechselweg SAM akkumulieren und dies wiederum fördert die Produktion von Cystein und a-Ketobutyrat, die beide glucogen sind, durch Cystathioninsynthase. Bei Methioninmangel kommt es zu einer Abnahme der SAM-Produktion, was die Aktivität der Cystathioninsynthase einschränkt.

Bergwerk:

MEt zu SAM ergibt Met-Produkt + SAHC, das Homcys und Adenosie sowie Alpha-Ketobutyrat produziert, das dann Proprionyl und Succinyll-Coa bildet. Wenn genügend Cys und erfüllte SAM akkumulieren, führen zu Cys und Alpha-Keto

Spezial: Verzweigte Ketten

. Die drei verzweigtkettigen Aminosäuren Isoleucin, Leucin und Valin treten über die Wirkung derselben beiden Enzyme in den katabolen Stoffwechselweg ein. Die anfängliche Desaminierung aller drei Aminosäuren wird durch eine von zwei verzweigtkettigen Aminosäuretransaminasen (BCATc oder BCATm) katalysiert. Die resultierenden α-Ketosäuren werden dann durch die Wirkung des Enzymkomplexes, der verzweigtkettigen Ketosäure-Dehydrogenase (BCKD), oxidativ decarboxyliert. Die BCKD-Reaktion erzeugt die CoA-Derivate der decarboxylierten Ketosäuren und erzeugt gleichzeitig den reduzierten Elektronenträger NADH. Nach diesen ersten beiden Reaktionen divergieren die restlichen Abbauwege für die drei Aminosäuren. Die dritte Reaktion des Abbaus von verzweigtkettigen Aminosäuren umfasst einen Dehydrierungsschritt, an dem drei verschiedene Enzyme beteiligt sind, eines für jedes der durch die BCKD-Reaktion erzeugten CoA-Derivate. Dieser letztere Dehydrierungsschritt liefert auch zusätzliche reduzierte Elektronenträger als FADH2. Die dritte Reaktion des Isoleucin-Katabolismus beinhaltet das Enzym kurz-/verzweigtkettige Acyl-CoA-Dehydrogenase (SBCAD). Das SBCAD-Enzym wird vom ACADSB-Gen kodiert. An der dritten Reaktion des Leucin-Katabolismus ist das Enzym Isovaleryl-CoA-Dehydrogenase (IVD) beteiligt. Die dritte Reaktion des Valin-Katabolismus beinhaltet das Enzym Isobutyryl-CoA-Dehydrogenase (IBD). Das IBD-Enzym wird von der Acyl-CoA-Dehydrogenase-Familie, dem Gen 8 (ACAD8), kodiert. Diese CoA-Dehydrogenasen gehören zur gleichen Enzymfamilie, die am Prozess der Mitochondrien beteiligt ist Fettsäureoxidation.

Schließlich Asp und Asn

med:

Asparaginase (siehe oben) ist auch im Körper weit verbreitet, wo sie Asparagin in Ammoniak und Aspartat umwandelt. Aspartat kann als Aminodonor in Transaminierungsreaktionen dienen, die Oxalacetat ergeben, das dem glukoneogenen Weg zu Glucose folgt.

Glutamat und Aspartat sind wichtig beim Sammeln und Eliminieren von Aminostickstoff über die Glutaminsynthetase bzw. den Harnstoffzyklus. Der katabole Weg der Kohlenstoffgerüste beinhaltet einfache 1-Schritt-Aminotransferase-Reaktionen, die direkt Nettomengen eines TCA-Zyklus-Zwischenprodukts produzieren. Die Glutamat-Dehydrogenase-Reaktion, die in Richtung der Produktion von 2-Oxoglutarat (α-Ketoglutarat) arbeitet, bietet einen zweiten Weg, der vom Glutamat zur Gluconeogenese führt.

Folgend aus: Lieu, E.L., Nguyen, T., Rhyne, S. et al. Aminosäuren bei Krebs. Exp Mol Med 52, 15–30 (2020).

Aminosäuren im Krebsstoffwechsel

Die metabolische Reprogrammierung ist ein Grundpfeiler des Wachstums und der Proliferation von Krebszellen. Sowohl essentielle als auch nicht-essentielle Aminosäuren (EAAs und NEAAs) unterstützen einen veränderten Stoffwechsel, indem sie als Energiequellen, biosynthetische Moleküle und Mediatoren des Redoxgleichgewichts dienen. Aminosäuren produzieren metabolische Zwischenprodukte wie Acetyl-CoA, die die Energiesynthese durch den Zitronensäurezyklus aufrechterhalten. Aminosäuren liefern auch Bausteine ​​für die Nukleotidsynthese und Lipogenese, die für die Wachstums- und Entwicklungsfähigkeit einer Zelle entscheidend sind. Um die Auswirkungen von oxidativem Stress zu umgehen, können Aminosäuren das Redox-Gleichgewicht durch ihre Produktion von Glutathion regulieren. Darüber hinaus trägt der EAA-Katabolismus durch chemische Reaktionen, einschließlich der durch Transaminasen vermittelten, zur Bildung von NEAAs bei. Aminosäuren sind grün und andere Metaboliten sind rot. Orange steht für Transporter. Gelbe Kästchen bedeuten Enzyme. SHMT1 Serinhydroxymethyltransferase, zytosolisch, BCAT verzweigtkettige Aminosäuretransaminase, mitochondrial, BCAA verzweigtkettige Aminosäure (Valin, Leucin, Isoleucin), BCKA verzweigtkettige Ketosäure, GOT1 Aspartattransaminase, zytosolisch (AST), GLS Glutaminase, GS Glutamin Synthetase (zytosolisch und mitochondrial), ASNS-Asparagin-Synthetase, PRODH-Pyrrolin-5-Carboxylat-Dehydrogenase, PYCR-Pyrrolin-5-Carboxylat-Reduktase, P5C-Pyrrolin-5-Carboxylat, GSH-Glutathion, Gly-Glycin, Ser-Serin-Zyklus, Met-Methionin, Met-Zyklus-Methion , Gln-Glutamin, Cys-Cystein, Glu-Glutamat, Asp-Aspartat, Pro-Prolin, Asn-Asparagin, Arg-Arginin, PRPP-Phosphoribosyl-Pyrophosphat, Acetyl-CoA Acetyl-Coenzym A, α-KG Alpha-Ketoglutarsäure, OAA Oxalessigsäure, LAT1 groß-neutral Aminosäuretransporter 1, SLC25A44-Trägerfamilie für gelöste Stoffe 25, Mitglied 44, GLUT-Glucosetransporter, TCA-Zyklus die Tricarbonsäure (auch als Zitronensäurezyklus bekannt).

Diese Abbildung wurde von Lieu, E.L., Nguyen, T., Rhyne, S. et al. Aminosäuren bei Krebs. Exp Mol Med 52, 15–30 (2020). https://doi.org/10.1038/s12276-020-0375-3, Dieser Artikel ist lizenziert unter einer Creative Commons Attribution 4.0 International License, die die Verwendung, Weitergabe, Anpassung, Verteilung und Reproduktion in jedem Medium oder Format erlaubt, solange Wenn Sie den/die ursprünglichen Autor(en) und die Quelle angemessen nennen, geben Sie einen Link zur Creative-Commons-Lizenz an und geben Sie an, ob Änderungen vorgenommen wurden. Um eine Kopie dieser Lizenz anzuzeigen, besuchen Sie http://creativecommons.org/licenses/by/4.0/.

Auch Metaboliten aus einer besonderen Funktion in der Epigentik und im Redoxhaushalt

Folgend aus: Lieu, E.L., Nguyen, T., Rhyne, S. et al. Aminosäuren bei Krebs. Exp Mol Med 52, 15–30 (2020).

ein Aminosäuren liefern metabolische Zwischenprodukte für die epigenetische Regulation. Ein-Kohlenstoff-Einheiten aus dem Methionin- (hier abgebildet) und Folat-Zyklus dienen als Methyl-Donor für DNA- und Histon-Methyltransferasen, während Acetyl-CoA aus BCAAs und Leucin für die Histon-Acetylierung verwendet werden kann. B Von Aminosäuren abgeleitetes Acetyl-CoA ist auch an der Modifikation der Proteinacetylierung beteiligt; ein auf Thrombopoietin (TPO) reagierender homodimerer Rezeptor, CD110, aktiviert den Lysin-Katabolismus, der Acetyl-CoA für die Acetylierung von LRP6 (ein Wnt-Signalprotein) erzeugt und die Selbsterneuerung von tumorinitiierenden Darmkrebszellen fördert24. C Erhöhte Kynurenin (Kyn)-Spiegel, die von Tryptophan über die Enzyme Tryptophan 2,3-Dioxygenase (TDO) und Indolamin 2,3-Dioxygenase (IDO) stammen, wurden bei mehreren Krebsarten, darunter Hodgkin-Lymphom, Lungenkrebs und Eierstockkrebs, nachgewiesen. Kynurenin fördert das Überleben von Tumorzellen, indem es sowohl den T-Zelltod induziert als auch eine Immuntoleranz in dendritischen Zellen (DCs) induziert. Methylierung und Acetylierung werden durch rote Me- bzw. blaue Ac-Kreise dargestellt. Histon-Methylierung und Acetylierung werden durch gekrümmte Linien dargestellt. DNA-Methylierung wird durch eine gerade Linie dargestellt. Orange steht für Rezeptoren. Gelbe Kästchen bedeuten Proteine. SAM S-Adenosylmethionin, SAH S-Adenosyl-Homocystein, Met-Methionin, Thr-Threonin, BCAAs verzweigtkettige Aminosäuren, Leu-Leucin, Lys-Lysin, Acetyl-CoA-Acetyl-Coenzym A, Trp-Tryptophan, Kyn-Kynurenin, IFN-γ-Interferon mTORC1-Säugetier-Target von Rapamycin-Komplex 1, TDH-Threonin-Dehydrogenase, EP300-Histon-Acetyltransferase p300, HAT-Histon-Acetyltransferase, CD110 myeloproliferatives Leukämie-Protein (Thrombopoietin-Rezeptor), TPO-Thrombopoietin, IDO-Indoleamin 2,3-Dioxygenase 2, TDI .-Tryptogenase 2,3-DO-Tryptogenase -4 zytotoxisches T-Lymphozyten-assoziiertes Protein 4, TR Zelle, regulatorische T-Zelle.

Diese Abbildung wurde von Lieu, E.L., Nguyen, T., Rhyne, S. et al. Aminosäuren bei Krebs. Exp Mol Med 52, 15–30 (2020). Um eine Kopie dieser Lizenz anzuzeigen, besuchen Sie http://creativecommons.org/licenses/by/4.0/.


Biosynthese von Aminosäuren: 3 Wege

Anorganischer Stickstoff in Form von NH3 oder Ammonium (NH4 + ), die als Ergebnis der Reduktion von Nitraten oder biologischer Stickstofffixierung hergestellt oder aus dem Boden gewonnen werden, reagieren mit a-Ketoglutarsäure (einem Zwischenprodukt des Krebs’-Zyklus) in Gegenwart des Enzyms Glutamindehydrognase (GDH) und des reduzierten Coenzyms NADPH + H zu einer Aminosäure, der Glutaminsäure (dh Glutamat) und wird somit in organische Form umgewandelt.

(B) GS/GOGAT – Weg:

Anorganischer Stickstoff in Form von Ammonium kann auch durch sequentielle Aktionen zweier Enzyme, der Glutaminsynthetase (GS) und der Glutamatsynthase (auch bekannt als Glutamin: 2-Oxo-Glutarat-Aminotransferase oder GOGAT) in Aminosäure (dh organische Form) umgewandelt werden. in Pflanzen gefunden.

Weg Nr. 2. Transaminierung:

Die verschiedenen anderen Aminosäuren, die schließlich zu Proteinen kondensieren, werden durch Transaminierungsreaktionen hergestellt, bei denen die Aminogruppe von Glutaminsäure in die Ketoposition der entsprechenden Ketosäure übertragen wird.

Eine Aminogruppe von anderen Aminosäuren außer Glutaminsäure kann auch auf andere Ketosäuren übertragen werden, wodurch entsprechende Aminosäuren gebildet werden. Transaminierungsreaktionen finden in Gegenwart von Enzymen Transminasen (Aminotransferasen) statt, die das Coenzym Pyridoxalphosphat (ein Derivat von Vitamin B .) benötigen6 d.h. Pyridoxin).

Als Träger der Aminogruppe fungiert das Coenzym Pyridoxalphosphat. Es nimmt die Aminogruppe der Donoraminosäure auf und wird in Pyridoxaminphosphat umgewandelt. Letztere überträgt diese Aminogruppe auf die Akzeptor-Ketosäure unter Bildung einer neuen Aminosäure und wird selbst in Pyridoxalphosphat umgewandelt, wie in Abbildung 9.6 gezeigt.

Obwohl mittlerweile eine Vielzahl von Transaminierungsreaktionen bekannt sind, sind die folgenden 3 sehr verbreitet:

Weg Nr. 3. Andere Methoden:

Aminosäuren können auch durch Umwandlung von Säureamiden und anderen stickstoffhaltigen Verbindungen oder durch Hydrolyse von Proteinen durch proteolytische Enzyme hergestellt werden.


Biochemie. 5. Auflage.

Was ist das Schicksal von Aminosäuren, die bei der Proteinverdauung oder beim Proteinumsatz freigesetzt werden? Nicht benötigte Bausteine ​​werden zu speziellen Verbindungen abgebaut. Der Hauptort des Aminosäureabbaus bei Säugetieren ist die Leber. Die Aminogruppe muss entfernt werden, da keine stickstoffhaltigen Verbindungen in Energieübertragungswegen vorhanden sind. Die α-Ketosäuren, die bei der Desaminierung von Aminosäuren entstehen, werden metabolisiert, sodass die Kohlenstoffgerüste als Vorläufer von Glukose- oder Zitronensäurezyklus-Zwischenprodukten in den metabolischen Mainstream gelangen können. Das Schicksal der α-Aminogruppe wird zuerst betrachtet, gefolgt von dem des Kohlenstoffgerüsts (Abschnitt 23.5).


Aminosäuren&mdashSynthese und Abbau | Pflanzenphysiologie

Wenn ein Protein hydrolysiert wird, werden bis zu 20 Aminosäuren unterschiedlicher Art produziert. Dies sind Proteinaminosäuren. Darüber hinaus sind auch Nicht-Protein-Aminosäuren vorhanden, die jedoch keine strukturellen Bestandteile von Proteinen bilden. Die Einzelheiten der chemischen Bezeichnung, des Molekulargewichts und der Strukturformeln sind in Tabelle 4-4 aufgeführt.

Über die Funktion von Nicht-Protein-Aminosäuren ist nichts Genaues bekannt. Ihre Anzahl und Konzentration variiert je nach Art und Organ. Samen einiger Arten enthalten überwiegend Homoarginin. Speicherorgane einiger Arten enthalten auch Derivate von Cystein.

Im Allgemeinen enthalten Nicht-Protein-Aminosäuren mehr Stickstoff als Protein-Aminosäuren und fungieren möglicherweise als Speicherstickstoff in den Samen, der für verschiedene Syntheseprozesse leicht mobilisiert werden kann. Andere Nicht-Protein-Aminosäuren sind Homoserin und Diaminopimelinsäure. Letzteres ist eine Zwischensubstanz der Lysin-Biosynthese, während Homoserin die Zwischensubstanz zwischen Methionin und Threonin ist.

Anscheinend bilden Nichtproteinaminosäuren Proteinaminosäuren oder bilden eine Gruppe von Sekundärmetaboliten. Über ihren Stoffwechsel ist jedoch noch viel zu verstehen. Im Allgemeinen sind die Aminogruppen aller Aminosäuren, die Proteine ​​bilden, am α-Kohlenstoff eingefügt, an den auch seine Carboxylgruppe gebunden ist. Die α-Aminosäure enthält R als Seitenkette (Abb. 4-13).

Basierend auf der Struktur der Seitenkette werden Proteinaminosäuren in sieben Gruppen eingeteilt. Eine Aminosäure umfasst ein Kohlenstoffgerüst und NH3 (Tabelle 4-4). Mit Hilfe von Radiotracern wurde gezeigt, dass die meisten Aminosäuren ein ähnliches Kohlenstoffgerüst aufweisen. Somit ist Oxalacetat die Quelle von Asparaginsäure, die weiter zu Lysin, Methionin, Threonin und Isoleucin führen kann.

Im Allgemeinen gibt es vier Aminosäurefamilien und diese sind die Pyruvat-, Aspartat-, Glutaminsäure- und Glyoxylat-Familie wie folgt:

Es wurde gezeigt, dass Glyoxylat aus Glykolat bei der Photosynthese oder aus dem Glyoxylat-Zyklus in den Glyoxysomen entsteht. Im Gegensatz dazu sind Pyruvat, Oxalacetat und α-Ketoglutarat die Zwischenprodukte im TCA-Zyklus.

Pflanzen können Stickstoff in jeder Form aufnehmen, aber es ist das Ammoniak, das in die Aminosäuren eingeht. In C4-Pflanzen wird zuerst die Asparaginsäure synthetisiert. In Pflanzen mit Photorespiration wird Ammoniak in Glyoxylat eingebaut, was Glycin, Serin und Cystenin ergibt.

Andererseits bilden C3-Pflanzen aus Ammoniak Alanin, Asparaginsäure, Glutaminsäure. Es wird auch berichtet, dass Pyruvat und Oxalacetat auch eine reduktive Aminierung eingehen könnten und die Reaktionen durch ihre jeweiligen Dehydrogenasen vermittelt werden. Dementsprechend werden Alanin- bzw. Asparaginsäure-Aminosäuren produziert. Wenn Glyoxylat vorhanden ist, kann Glycin erhalten werden.

Glutamin und Asparagin sind die Amide von Glutaminsäure bzw. Asparaginsäure. Ammoniak kann auch durch andere Mechanismen assimiliert werden, z. B. Aspartase-Reaktion und Carbamylphosphat-Synthetase-Reaktion.

Bei der ersteren Reaktion reagieren Fumarat und Ammoniak zu Asparaginsäure, während bei der letzteren CO2, ATP und Ammoniak reagieren zu Carbamylphosphat. Letzteres Produkt wird bei der Bildung von Citrullin aus Ornithin verwendet. Glutaminsäure und Asparaginsäure werden als primäre Aminosäuren bezeichnet und andere Aminosäuren gehen aus ihnen hervor.

Für die lebenden Organismen sind verschiedene Reaktionen zur Freisetzung von Ammoniak aus Aminosäuren von größter Bedeutung, z.B. Ammoniak, das aus einer Aminosäure freigesetzt wird, kann zur Herstellung einer anderen verwendet werden, zweitens können desaminierte Aminosäuren zu Wasser und CO . oxidiert werden2 durch den TCA-Zyklus oder sogar Glukose durch Umkehrung der Glykolyse bilden.

Darüber hinaus ist Ammoniak selbst in geringen Konzentrationen toxisch und die Zelle hat verschiedene Systeme entwickelt, um diese zelluläre Toxizität zu überprüfen. In Pflanzen kann auch viel Ammoniak in Form von Glutamin und Asparagin gespeichert werden. Die Amide stellen eine Speicherform der Stickstoffreserve dar.

Funktionen verschiedener Aminosäuren (Tabelle 4-4):

Diese Aminosäure kann durch die Transaminierung mehrerer Aminosäuren wie Glutamin, Asparagin, Aspartat, Glutamat und sogar Glyoxylat gebildet werden.

Bei der Desaminierung kann Glycin in Glyoxylat eindringen und durch den Glyoxylatzyklus wird es zu Glucose oxidiert.

Es ist ein Bestandteil von Purin, Porphyrinring von Chlorophyllen, Cytochromen und sogar Proteinen. Es ist eine Vorstufe von Serin.

Durch Transaminierung kann es zu anderen Aminosäuren führen und bildet durch Desaminierung sogar Pyruvat. Es ist ein Teil des Proteins.

Glycin kann zu Serin führen oder wenn Alanin durch Transaminierung mit Phosphohydroxypyruvat kombiniert wird. Es nimmt auch an der Purin- und Pyrimidinsynthese teil und kann in die amphibolischen Stoffwechselwege eintreten.

Es ist ein wichtiger Bestandteil von Proteinen und bildet durch Desaminierung α-Ketobutyrat. Durch intramolekulare Umwandlung wird es aus Phosphohomoserin gebildet.

Valin, Leucin und Isoleucin:

Durch Threonin-Deaminase wird Threonin desaminiert, um α-Ketobutyrat zu produzieren, aus dem Isoleucin durch eine Reihe von Schritten entstehen kann.

Die Bildung von Valin und Leucin ist nicht gut verstanden. Die drei Aminosäuren bilden aktive Bestandteile von enzymatischen Proteinen.

Diese Aminosäure kann sich aus Alpha-Aminoadipinsäure oder Asparagin-β-Semialdehyd durch Umwandlung in Diaminopimelinsäure in mehreren Schritten entwickeln.

Es bildet mehrere Aminosäuren wie Lysin, Threonin und ist Bestandteil von Proteinen. Es kann auch zu nicht-proteinbildenden Aminosäuren wie Homoserin führen.

Es kann auch durch mehrere Abbaureaktionen in Oxalacetat und α-Ketoglutarat umgewandelt werden. Diese können bei vollständiger Oxidation Glucose oder Fettsäuren bilden oder sogar ATP bilden.

Ornithin, Citrullin, Arginin und Prolin:

Sie gehören zur Familie der Glutaminsäuren. Arginin, Prolin und Hydroxyprolin sind Proteinaminosäuren, während Citrullin, Ornithin und Alpha-Aminobuttersäure Nicht-Proteinaminosäuren sind.

Diese Gruppe umfasst Methionin und Cystein. Während erstere aus Asparaginsäure gebildet wird, wird letztere durch einige Reaktionen aus Methionin hergestellt. Die Methylgruppe spielt eine bedeutende Rolle bei der Biosynthese mehrerer Substanzen wie Cholin und Methionin ist der gemeinsame Donor der Methylgruppe bei solchen Reaktionen.

Cystein ist eine Schlüsselaminosäure, die an der Tertiärstruktur von Proteinen beteiligt ist und die funktionelle Gruppe mehrerer Enzyme bildet. Es ist an der Initiation der Proteinsynthese beteiligt. Wenn Methionin fehlt, kann die Proteinsynthese in den Zellen nicht stattfinden.

Diese Kategorie umfasst Tryptophan, Tyrosin, Histidin und Phenylalanin. Die Vorstufe der Aminosäure Tryosin und Phenylalanin ist Shikimisäure.

Über den Histidin-Weg in Pflanzen ist nichts Spezifisches bekannt. Über den Metabolismus von aromatischen Aminosäuren gibt es nicht viele Informationen.

Einige der strukturellen und enzymatischen Proteine ​​in Pflanzen enthalten sie jedoch. Es wird berichtet, dass Shikmat-Dehydrogenase mit Plastiden verschiedener Pflanzengewebe assoziiert ist.

Eine Transaminierungsreaktion ist durch die Übertragung einer Aminogruppe gekennzeichnet. Genauer gesagt wird eine Aminogruppe von einer Donor-Aminosäure auf eine Akzeptor-α-Ketosäure übertragen, was die α-Ketosäure der Donor-Aminosäure und die Aminosäure des ursprünglichen α-Ketosäure-Akzeptors ergibt.

Die Transaminierungsreaktion erfordert ein Metallion und eine Pyridoxalphosphat-Aktivität wie unten gezeigt (Abb. 4-13 A, B):

Kohlenstofftransformationen:

Bei einigen Aminosäuren ist das basische Kohlenstoffgerüst modifiziert oder durch verschiedene Gruppen an ihrer Kohlenstoffkette ersetzt. Dadurch werden neue Aminosäuren gebildet.

Im Allgemeinen bestehen zwischen verschiedenen Aminosäuren spezifische metabolische Beziehungen. Im Folgenden werden Hauptfamilien zusammen mit anderen Verbindungen und Aminosäuren angegeben (Abb.4-15).

Die Hauptfunktion von Aminosäuren in einer Zelle ist die Umwandlung und der Stoffwechsel von Energie. Einige Wege beinhalten jedoch Aminosäuren, z. B. der Glykolat-Weg der Zuckersynthese, der Glycin und Serin umfasst. In ähnlicher Weise können Malat, Aspartat und OAA als die Carboxyl transportierenden C4-Säuren fungieren.

Methionin ist an der Synthese methylierter Verbindungen über Transmethylierungsreaktionen beteiligt. Tryptophan ist eine Vorstufe von Indolessigsäure. Hydroxyprolin ist ein Bestandteil der Wandverlängerung.

Vieles deutet darauf hin, dass Amide wichtige Entgiftungsprodukte sind, wenn Pflanzen Ammoniak aus externen Quellen ausgesetzt sind. Entweder Glutamin oder Asparagin können die Hauptform von assimiliertem Stickstoff sein, der sich unter diesen Bedingungen ansammelt. Die Akkumulation von Amiden scheint das wichtigste Mittel zur Bekämpfung der Ammoniaktoxizität während der Blattalterung zu sein.

Glutamin und Asparagin sind zwei Amide, die maßgeblich zum Stickstoffstoffwechsel der Pflanzen beitragen. Amino- und Amidogruppen dieser Amide sind an mehreren Transaminierungs- und Desaminierungsreaktionen beteiligt. Amide sind die wichtigsten Speicher- und Transportverbindungen von Stickstoff in Pflanzen. Die beiden Amide sind Homologe, die sich in der Kettenlänge um ein Kohlenstoffatom unterscheiden.

Ihr Verhalten ist jedoch biochemisch und physiologisch unterschiedlich. Glutamin beispielsweise ist in Wasser sehr gut löslich, während Asparagin unlöslich ist. Andererseits ist Asparagin stabil und muss in starker Säure erhitzt werden, um es zu hydrolysieren. Glutamin ist instabiler und hydrolysiert in kochendem Wasser zu Glutaminsäure. Die Ninhydrin-Reaktion für die beiden ist variabel. Glutamin setzt beispielsweise CO . frei2 und bildet eine violette Farbe, während Asparagin eine braune Farbe ergibt.

Glutamin wird wie folgt aus Glutaminsäure und Ammoniak synthetisiert:

Wie oben gezeigt wird Energie durch die Hydrolyse von ATP bereitgestellt. Es besteht auch ein Bedarf für Mg +2 , Mn +2 und Co +2 .

Die enzymatische Umwandlung von Glutamin in Glutaminsäure benötigt ADP und Pi. Ebenso ist das Enzym, das Asparaginsäure in Asparagin umwandelt, nicht gut charakterisiert.

Die folgende Reaktion gibt jedoch eine Vorstellung von der Kombination von Asparaginsäure mit Ammoniak.

Auch in Pflanzen gibt es viele andere Wege, über die Asparagin hergestellt wird. Viele dieser Daten stammen aus den Isotopenexperimenten.

Einige der Pflanzen haben einen hohen Cyanid (CN)-Stoffwechsel und der Gehalt an Cyanoglykosid ist hier hoch. HCN wird wie folgt in Asparagin eingebaut:

Es gibt auch Hinweise darauf, dass Asparagin durch Kondensation von C . gebildet wird1 + C2. In den keimenden Samen einiger Pflanzen kann Asparagin aus dem Protein oder aus der Aminierung von Asparaginsäure gewonnen werden, die durch Hydrolyse von Protein erhalten wird.

Asparagin wird auch aus Asparaginsäure gewonnen, die aus dem Zitronensäurezyklus gewonnen wird. Es kann auch aus den Stoffwechselprodukten körpereigener Zucker gewonnen werden. Der größte Teil des Asparagins stammt aus der Hydrolyse von Proteinen. Glutamin kann aus Glutaminsäure gewonnen werden, die während des Proteinabbaus freigesetzt wird, oder es kann auch direkt aus der Photosynthese hergestellt werden.

Wird Stickstoff in Form von Ammoniak oder Nitrat verabreicht, wird die Glutaminbildung angeregt.

Glutamin ist ein potenter Stickstoffspender in mehreren Syntheseprozessen und liefert Stickstoffatome an den Positionen 3 und 9 des Purinrings und den Amidstickstoff von NAD und NADP. Amidstickstoff wird auch bei der Bereitstellung von Chitinmonomeren verwendet. Glutamin liefert auch zyklischen Stickstoff für Histidin und Tryptophan.

Pflanzen enthalten auch mit Glutamin verwandte Verbindungen und einige davon werden nicht leicht metabolisiert. Die beiden Amide erfüllen spezifische Funktionen und einige dieser Funktionen überlappen sich. Über ihren Stoffwechsel ist noch viel zu verstehen. In jedem Fall akkumulieren Amide aufgrund von schwerem Stickstoff und sind an der Stickstofftranslokation beteiligt.

Asparagin wird als Protein in den Samen einiger Leguminosenarten gespeichert, während Glutamin die vorherrschende Translokationssubstanz in den schnell wachsenden Pflanzen ist. Außerdem ist Glutamin an der Stickstofftranslokation beteiligt, die für die Proteinsynthese verwendet wird, während die Akkumulation von Asparagin mit der Proteinhydrolyse verbunden ist.

Es gibt auch die Ansicht, dass Asparagin auf einen ungesunden Zustand einer Pflanze hinweist, während es bei Glutamin umgekehrt ist. Einige Arbeiter haben eine Dominanz von Glutamin in Pflanzen gezeigt, die unter warmen, trockenen Langtagbedingungen angebaut wurden. Die Hauptrolle der beiden Amide kann als Stickstoff, Ammoniakentgiftung und Speichermobilisierung von Stickstoff für die Synthese zusammengefasst werden.


Diskussion

Stickstoffbegrenzung während des weiteren Wachstums von Y. lipolytica provoziert eine dramatische Reaktion der Biomassezusammensetzung, d. h. einen anhaltenden Anstieg praktisch aller Lipide. Es wurde vorgeschlagen, dass eine wichtige Rolle in diesem Prozess die Hemmung der AMP-abhängigen Isocitrat-Dehydrogenase, hervorgerufen durch eine erhöhte Aktivität der AMP-Deaminase, ist. 41 Obwohl die Transkriptionsregulation wahrscheinlich eine weitere wichtige Rolle bei dieser Reaktion spielt, da nicht nur eine signifikante Anzahl von Transkripten, sondern auch viele TFs unterschiedlich exprimiert werden, scheint es, dass der Lipidstoffwechsel selbst einer sehr begrenzten Transkriptionsregulation unterliegt. Das metabolische Netzwerk ist so angepasst, dass es den Kohlenstofffluss von Wegen ablenkt, die Stickstoff benötigen, wie dem Aminosäurestoffwechsel, während die Lipidbiosynthesewege anscheinend hoch genug aktiv sind, um diesen erhöhten Fluss zu beherbergen. Dennoch ist es wahrscheinlich, dass eine zusätzliche Regulation wie posttranslationale Modifikationen stattfindet, da bekannt ist, dass die Acc1-Aktivität durch Phosphorylierung durch Snf1 reprimiert wird, was wahrscheinlich zum öligen Phänotyp in der beiträgt SNF1-schlagen. Dies bestätigt die Ergebnisse aus Fed-Batch-Kultivierungen von Y. lipolytica, wo auch eine eingeschränkte transkriptionelle Regulation des Lipidstoffwechsels beobachtet wurde. 31 Darüber hinaus R. toruloides die limitierte transkriptionelle Regulation des Lipidstoffwechsels konzentriert sich hauptsächlich auf die Herunterregulierung der β-Oxidation. 32 Obwohl Y. lipolytica die Expression seines Fettstoffwechsels nicht zu regulieren scheint, wurden metabolische Engineering-Anstrengungen unternommen, um die Lipidausbeute durch Überexpression zusätzlicher Kopien nativer Gene, die am Fettstoffwechsel beteiligt sind, zu erhöhen, wie z ACC1, DGA1 und kürzlich Stearoyl-CoA-Desaturase. 15 Diese Bemühungen waren erfolgreich, sie ignoriert jedoch die ursprünglichen Regulationsmechanismen der Zelle. Die Berücksichtigung des nativen regulatorischen Netzwerks wird zu robusteren und höheren Lipidausbeuten führen, und unsere Ergebnisse könnten die Kopplung von Wachstum und Lipidakkumulation ermöglichen, die für die Erzielung hoher spezifischer Produktivitäten von TAG erforderlich sind.

Eine systematischere Untersuchung der Lipidakkumulation in ölhaltigen Hefen erfordert ein qualitativ hochwertiges Framework zur Integration der verschiedenen Daten, das wir hier mit einem hochwertigen Genom-Scale-Modell von Y. lipolytica. Unsere Ergebnisse weisen darauf hin, dass Snf1 von Natur aus keine wichtige Rolle bei der Lipidakkumulation spielt, wie zuvor postuliert. Somit, obwohl ein Knockout von SNF1 zu einem öligen Phänotyp führt, ist das Transkriptionsprofil das Gegenteil von dem, was während der durch Stickstoffrestriktion induzierten Lipidakkumulation passiert. Unsere Ergebnisse deuten daher darauf hin, dass die Lipidakkumulation in Y. lipolytica bei Stickstofflimitierung ist dem Überlaufstoffwechsel ähnlich, der bei vielen anderen Mikroorganismen beobachtet wird, z.B. Ethanolproduktion von S. cerevisiae bei Stickstofflimitierung, und mehr im Einklang mit dem, was bei Säugetieren beobachtet wird, bei denen ein hohes Kohlenstoff-Stickstoff-Verhältnis in der Nahrung zu einer TAG-Akkumulation führt.


18.5: Wege des Aminosäureabbaus – Biologie

Die gezielte Behandlung des Aminosäurestoffwechsels ist eine attraktive Therapieform, da sie langfristige behandlungsbedingte Toxizitäten mildern kann, indem der Bedarf an genotoxischen Wirkstoffen verringert wird.

Die Wirkung von Therapien zum Abbau von Aminosäuren kann weiter verstärkt werden, wenn sie entweder mit konventionellen Therapien oder durch gezielte Behandlung von tumorzellspezifischen Überlebensmechanismen kombiniert werden.

Eine Reihe neuer Strategien zum Abbau von Aminosäuren wird derzeit klinisch untersucht.

Die gezielte Behandlung des Tumorzellstoffwechsels ist eine attraktive Therapieform, da sie das Ansprechen auf die Behandlung bei therapieresistenten Krebsarten verbessern und behandlungsbedingte Toxizitäten durch Verringerung des Bedarfs an genotoxischen Wirkstoffen abschwächen kann. Um ihren erhöhten Bedarf an Biomasseakkumulation und Energieproduktion zu decken und die Redoxhomöostase aufrechtzuerhalten, unterliegen Tumorzellen tiefgreifenden Veränderungen in ihrem Stoffwechsel. Dies wird neben der Umleitung des Glukosestoffwechsels durch eine Hochregulierung des Aminosäurestoffwechsels erreicht. Die Beeinträchtigung der Verfügbarkeit von Aminosäuren kann für Tumorzellen selektiv tödlich sein und hat sich als krebsspezifische Achillesferse erwiesen. Hier besprechen wir die Biologie hinter solchen krebsspezifischen Aminosäureabhängigkeiten und diskutieren, wie diese Schwachstellen ausgenutzt werden können, um Krebstherapien zu verbessern.


Aminosäure- und Hämstoffwechsel

Abbau von verzweigtkettigen Aminosäuren zu Succinyl-Coenzym A und Acetoacetyl-Coenzym A

Die Transaminierung von Leucin, Isoleucin und Valin (verzweigtkettige Aminosäuren) ergibt verzweigtkettige α-Ketosäuren. Darauf folgt die oxidative Decarboxylierung dieser α-Ketosäuren durch verzweigtkettige α-Ketosäure-Dehydrogenase-Multienzymkomplexe, die denen ähnlich sind, die die Pyruvat- und α-Ketoglutarat-Oxidation katalysieren. Valin und Isoleucin werden in Succinyl-CoA umgewandelt und Leucin wird in Acetoacetyl-CoA umgewandelt (siehe Fig. 12-6).

Histamin

Histidin-Decarboxylase produziert Histamin direkt aus Histidin. Histamin ist ein potenter Vasodilatator und wird während der allergischen Reaktion von Mastzellen freigesetzt. Dieses Autacoid entspannt die glatte Muskulatur in den Blutgefäßen und kontrahiert die glatte Muskulatur in den Bronchien und im Darm. Viele Allergiemedikamente blockieren die Bindung von Histamin an sein H1 Rezeptor, verhindert Vasodilatation und Kapillarpermeabilität.


18.5: Wege des Aminosäureabbaus – Biologie

Alle von MDPI veröffentlichten Artikel werden sofort weltweit unter einer Open-Access-Lizenz verfügbar gemacht. Für die Wiederverwendung des gesamten oder eines Teils des von MDPI veröffentlichten Artikels, einschließlich Abbildungen und Tabellen, ist keine besondere Genehmigung erforderlich. Bei Artikeln, die unter einer Open-Access-Creative Common CC BY-Lizenz veröffentlicht wurden, darf jeder Teil des Artikels ohne Genehmigung wiederverwendet werden, sofern der Originalartikel eindeutig zitiert wird.

Feature Papers stellen die fortschrittlichste Forschung mit erheblichem Potenzial für eine große Wirkung auf diesem Gebiet dar. Feature Papers werden auf individuelle Einladung oder Empfehlung der wissenschaftlichen Herausgeber eingereicht und vor der Veröffentlichung einem Peer Review unterzogen.

Das Feature Paper kann entweder ein origineller Forschungsartikel, eine umfangreiche neue Forschungsstudie sein, die oft mehrere Techniken oder Ansätze umfasst, oder ein umfassendes Übersichtspapier mit prägnanten und präzisen Updates zu den neuesten Fortschritten auf diesem Gebiet, das die aufregendsten Fortschritte in der Wissenschaft systematisch überprüft Literatur. Diese Art von Papier gibt einen Ausblick auf zukünftige Forschungsrichtungen oder mögliche Anwendungen.

Editor’s Choice-Artikel basieren auf Empfehlungen der wissenschaftlichen Herausgeber von MDPI-Zeitschriften aus der ganzen Welt. Die Herausgeber wählen eine kleine Anzahl von kürzlich in der Zeitschrift veröffentlichten Artikeln aus, die ihrer Meinung nach für Autoren besonders interessant oder in diesem Bereich wichtig sind. Ziel ist es, eine Momentaufnahme einiger der spannendsten Arbeiten zu geben, die in den verschiedenen Forschungsbereichen der Zeitschrift veröffentlicht wurden.


Inhalt

Ubiquitin (ursprünglich, ubiquitäres immunpoetisches Polypeptid) wurde erstmals 1975 [1] als ein 8,6-kDa-Protein identifiziert, das in allen eukaryontischen Zellen exprimiert wird. Die grundlegenden Funktionen von Ubiquitin und die Komponenten des Ubiquitylierungsweges wurden Anfang der 1980er Jahre am Technion von Aaron Ciechanover, Avram Hershko und Irwin Rose aufgeklärt, für die 2004 der Nobelpreis für Chemie verliehen wurde. [11]

Das Ubiquitylierungssystem wurde ursprünglich als ATP-abhängiges proteolytisches System charakterisiert, das in Zellextrakten vorhanden ist. Es wurde gefunden, dass ein in diesen Extrakten vorhandenes hitzestabiles Polypeptid, der ATP-abhängige Proteolysefaktor 1 (APF-1), in einem ATP- und Mg 2+ -abhängigen Prozess kovalent an das Modellproteinsubstrat Lysozym gebunden wird. [13] Mehrere APF-1-Moleküle wurden über eine Isopeptidbindung an ein einzelnes Substratmolekül gebunden, und es wurde festgestellt, dass Konjugate unter Freisetzung von freiem APF-1 schnell abgebaut werden. Kurz nach der Charakterisierung der APF-1-Proteinkonjugation wurde APF-1 als Ubiquitin identifiziert. Die Carboxylgruppe des C-terminalen Glycinrests von Ubiquitin (Gly76) wurde als die an Substratlysinreste konjugierte Einheit identifiziert.

Ubiquitin-Eigenschaften (Mensch) [ welcher? ]
Anzahl Reste 76
Molekulare Masse 8564.8448 Da
Isoelektrischer Punkt (pI) 6.79
Gennamen RPS27A (UBA80, UBCEP1), UBA52 (UBCEP2), UBB, UBC
Sequenz (Einbuchstabe) MQIFVKTLTGKTITELVEPSDTIENVKEINKIQDKEGIPPD

QQRLIFAGKQLEDGRTLSDYNIQKESTHLLVLRLRGG

Ubiquitin ist ein kleines Protein, das in allen eukaryontischen Zellen vorkommt. Es erfüllt seine unzähligen Funktionen durch Konjugation an eine Vielzahl von Zielproteinen. Es können verschiedene Modifikationen auftreten. Das Ubiquitin-Protein selbst besteht aus 76 Aminosäuren und hat eine Molekülmasse von etwa 8,6 kDa. Zu den Hauptmerkmalen gehören sein C-terminaler Schwanz und die 7 Lysinreste. Es ist während der gesamten eukaryotischen Evolution hoch konserviert, menschliches und Hefe-Ubiquitin haben eine Sequenzidentität von 96%. [ Zitat benötigt ]

Ubiquitin wird in Säugetieren von 4 verschiedenen Genen kodiert. Die Gene UBA52 und RPS27A kodieren für eine einzelne Kopie von Ubiquitin, fusioniert mit den ribosomalen Proteinen L40 bzw. S27a. Die UBB- und UBC-Gene kodieren für Polyubiquitin-Vorläuferproteine. [3]

Ubiquitylierung (auch bekannt als Ubiquitinierung oder Ubiquitinylierung) ist eine enzymatische posttranslationale Modifikation, bei der ein Ubiquitinprotein an ein Substratprotein angelagert wird. Dieser Prozess bindet am häufigsten die letzte Aminosäure von Ubiquitin (Glycin 76) an einen Lysinrest auf dem Substrat. Zwischen der Carboxylgruppe (COO − ) des Glycins des Ubiquitins und der Epsilon-Aminogruppe (ε- NH +
3 ) des Lysins des Substrats. [14] Die Trypsinspaltung eines Ubiquitin-konjugierten Substrats hinterlässt einen Diglycin-"Rest", der verwendet wird, um die Ubiquitylierungsstelle zu identifizieren. [15] [16] Ubiquitin kann auch an andere Stellen in einem Protein gebunden werden, bei denen es sich um elektronenreiche Nukleophile handelt, was als "nicht-kanonische Ubiquitylierung" bezeichnet wird. [9] Dies wurde zuerst beobachtet, als die Amingruppe des N-Terminus eines Proteins für die Ubiquitylierung anstelle eines Lysinrestes im Protein MyoD verwendet wurde [17] und wurde seitdem in 22 anderen Proteinen in mehreren Spezies beobachtet, [18 ] [19] [20] [21] [22] [23] [24] [25] [26] [27] [28] [29] [30] [31] [32] [33] [34] [ 35] [36] einschließlich Ubiquitin selbst. [37] [38] Es gibt auch zunehmend Hinweise auf Nicht-Lysin-Reste als Ubiquitylierungsziele unter Verwendung von Nicht-Amin-Gruppen, wie der Sulfhydrylgruppe an Cystein, [33] [34] [39] [40] [41] [42] [ 43] [44] [45] [46] und die Hydroxylgruppe an Threonin und Serin. [33] [34] [39] [45] [46] [47] [48] [49] [50] Das Endergebnis dieses Prozesses ist die Addition eines Ubiquitin-Moleküls (Monoubiquitylierung) oder einer Kette von Ubiquitin-Molekülen ( Polyubiquitinierung) zum Substratprotein. [51]

Die Ubiquitinierung erfordert drei Arten von Enzymen: Ubiquitin-aktivierende Enzyme, Ubiquitin-konjugierende Enzyme und Ubiquitin-Ligasen, bekannt als E1s, E2s bzw. E3s. Der Prozess besteht aus drei Hauptschritten:

  1. Aktivierung: Ubiquitin wird in einer zweistufigen Reaktion durch ein E1-Ubiquitin-aktivierendes Enzym aktiviert, das von ATP abhängig ist. Der erste Schritt beinhaltet die Produktion eines Ubiquitin-Adenylat-Zwischenprodukts. Das E1 bindet sowohl ATP als auch Ubiquitin und katalysiert die Acyl-Adenylierung des C-Terminus des Ubiquitin-Moleküls. Im zweiten Schritt wird Ubiquitin auf einen Cysteinrest des aktiven Zentrums übertragen, wobei AMP freigesetzt wird. Dieser Schritt führt zu einer Thioesterbindung zwischen der C-terminalen Carboxylgruppe von Ubiquitin und der E1-Cysteinsulfhydrylgruppe. [14] [52] Das menschliche Genom enthält zwei Gene, die Enzyme produzieren, die Ubiquitin aktivieren können: UBA1 und UBA6. [53]
  2. Konjugation: E2-Ubiquitin-konjugierende Enzyme katalysieren den Transfer von Ubiquitin von E1 zum Cystein des aktiven Zentrums von E2 über eine Trans(thio)-Veresterungsreaktion. Um diese Reaktion durchzuführen, bindet das E2 sowohl an aktiviertes Ubiquitin als auch an das E1-Enzym. Der Mensch besitzt 35 verschiedene E2-Enzyme, während andere eukaryotische Organismen zwischen 16 und 35 haben. Sie zeichnen sich durch ihre hochkonservierte Struktur aus, die als Ubiquitin-konjugierende katalytische (UBC) Faltung bekannt ist. [54]

In der Ubiquitinierungskaskade kann E1 mit vielen E2s binden, die hierarchisch mit Hunderten von E3s binden können. Das Vorhandensein von Niveaus innerhalb der Kaskade ermöglicht eine strenge Regulierung der Ubiquitinierungsmaschinerie. [7] Andere Ubiquitin-ähnliche Proteine ​​(UBLs) werden ebenfalls über die E1-E2-E3-Kaskade modifiziert, obwohl es Variationen dieser Systeme gibt. [57]

E4-Enzyme oder Ubiquitin-Kettenverlängerungsfaktoren sind in der Lage, vorgeformte Polyubiquitin-Ketten zu Substratproteinen hinzuzufügen. [58] Beispielsweise kann auf eine multiple Monoubiquitylierung des Tumorsuppressors p53 durch Mdm2 [59] die Addition einer Polyubiquitinkette mit p300 und CBP folgen. [60] [61]

Typen Bearbeiten

Die Ubiquitinierung beeinflusst den zellulären Prozess, indem sie den Abbau von Proteinen reguliert (über das Proteasom und Lysosom), die zelluläre Lokalisierung von Proteinen koordiniert, Proteine ​​aktiviert und inaktiviert und Protein-Protein-Wechselwirkungen moduliert. [4] [5] [6] Diese Effekte werden durch verschiedene Arten der Substrat-Ubiquitinierung vermittelt, zum Beispiel die Addition eines einzelnen Ubiquitin-Moleküls (Monoubiquitinierung) oder verschiedene Arten von Ubiquitin-Ketten (Polyubiquitinierung). [62]

Monoubiquitinierung Bearbeiten

Monoubiquitinierung ist die Anlagerung eines Ubiquitinmoleküls an einen Substratproteinrest. Multimonoubiquitinierung ist die Anlagerung eines Ubiquitinmoleküls an mehrere Substratreste. Die Monoubiquitinierung eines Proteins kann andere Auswirkungen haben als die Polyubiquitinierung desselben Proteins. Es wird angenommen, dass die Zugabe eines einzelnen Ubiquitin-Moleküls vor der Bildung von Polyubiquitin-Ketten erforderlich ist. [62] Monoubiquitinierung beeinflusst zelluläre Prozesse wie Membrantransport, Endozytose und virale Knospung. [10] [63]

Polyubiquitinketten Bearbeiten

Polyubiquitinierung ist die Bildung einer Ubiquitinkette an einem einzelnen Lysinrest auf dem Substratprotein. Nach der Addition einer einzelnen Ubiquitin-Einheit an ein Proteinsubstrat können weitere Ubiquitin-Moleküle an die erste angefügt werden, wodurch eine Polyubiquitin-Kette entsteht. [62] Diese Ketten werden hergestellt, indem der Glycinrest eines Ubiquitin-Moleküls an ein Lysin von Ubiquitin gebunden an ein Substrat gebunden wird. Ubiquitin hat sieben Lysinreste und einen N-Terminus, der als Ubiquitinierungspunkte dient. Sie sind K6, K11, K27, K29, K33, K48, K63 bzw. M1. [8] Lysin-48-linked-Ketten wurden zuerst identifiziert und sind die am besten charakterisierte Art von Ubiquitin-Ketten. K63-Ketten wurden ebenfalls gut charakterisiert, während die Funktion anderer Lysinketten, gemischter Ketten, verzweigter Ketten, M1-verknüpfter linearer Ketten und heterologer Ketten (Mischungen aus Ubiquitin und anderen Ubiquitin-ähnlichen Proteinen) unklarer bleibt. [16] [38] [62] [63] [64]

Lysin-48-verknüpfte Polyubiquitinketten zielen auf Proteine ​​zur Zerstörung durch einen Prozess, der als Proteolyse bekannt ist. Multi-Ubiquitin-Ketten mit einer Länge von mindestens vier Ubiquitin-Molekülen müssen an einen Lysin-Rest des verurteilten Proteins angehängt werden, damit es vom 26S-Proteasom erkannt wird. [65] Dies ist eine tonnenförmige Struktur mit einem zentralen proteolytischen Kern aus vier Ringstrukturen, flankiert von zwei Zylindern, die selektiv den Eintritt ubiquitinierter Proteine ​​ermöglichen. Im Inneren werden die Proteine ​​schnell zu kleinen Peptiden (normalerweise 3–25 Aminosäurereste lang) abgebaut. Ubiquitin-Moleküle werden unmittelbar vor der Zerstörung vom Protein abgespalten und zur weiteren Verwendung recycelt. [66] Obwohl die meisten Proteinsubstrate ubiquitiniert sind, gibt es Beispiele für nicht-ubiquitinierte Proteine, die auf das Proteasom abzielen. [67] Die Polyubiquitinketten werden von einer Untereinheit des Proteasoms erkannt: S5a/Rpn10. Dies wird durch ein Ubiquitin-Interaktionsmotiv (UIM) erreicht, das sich in einem hydrophoben Patch in der C-terminalen Region der S5a/Rpn10-Einheit befindet. [4]

Lysin-63-verknüpfte Ketten sind nicht mit dem proteasomalen Abbau des Substratproteins verbunden. Stattdessen ermöglichen sie die Koordination anderer Prozesse wie endozytischer Handel, Entzündung, Translation und DNA-Reparatur. [10] In Zellen werden 63-verknüpfte Lysinketten durch den ESCRT-0-Komplex gebunden, der ihre Bindung an das Proteasom verhindert. Dieser Komplex enthält zwei Proteine, Hrs und STAM1, die ein UIM enthalten, das es ihm ermöglicht, an Lysin-63-verknüpfte Ketten zu binden. [68] [69]

Über atypische (nicht Lysin 48-verknüpfte) Ubiquitinketten ist weniger bekannt, aber die Forschung beginnt, Rollen für diese Ketten vorzuschlagen. [63] Es gibt Hinweise darauf, dass atypische Ketten, die durch Lysin 6, 11, 27, 29 und Methionin 1 verbunden sind, den proteasomalen Abbau induzieren können. [67] [70]

Verzweigte Ubiquitinketten mit mehreren Bindungstypen können gebildet werden. [71] Die Funktion dieser Ketten ist unbekannt. [8]

Struktur bearbeiten

Unterschiedlich verknüpfte Ketten haben spezifische Auswirkungen auf das Protein, an das sie gebunden sind, verursacht durch unterschiedliche Konformationen der Proteinketten. K29-, K33-, [72] K63- und M1-verknüpfte Ketten haben eine ziemlich lineare Konformation und werden als Ketten mit offener Konformation bezeichnet. K6-, K11- und K48-verknüpfte Ketten bilden geschlossene Konformationen. Die Ubiquitinmoleküle in Ketten mit offener Konformation interagieren nicht miteinander, mit Ausnahme der kovalenten Isopeptidbindungen, die sie miteinander verbinden. Im Gegensatz dazu haben die geschlossenen Konformationsketten Schnittstellen mit wechselwirkenden Resten. Die Veränderung der Kettenkonformationen legt verschiedene Teile des Ubiquitinproteins frei und verdeckt sie, und die unterschiedlichen Verknüpfungen werden von Proteinen erkannt, die spezifisch für die einzigartigen Topologien sind, die der Verknüpfung eigen sind. Proteine ​​können über Ubiquitin-bindende Domänen (UBDs) spezifisch an Ubiquitin binden. Die Abstände zwischen einzelnen Ubiquitin-Einheiten in Ketten unterscheiden sich zwischen 63- und 48-verknüpften Lysinketten. Die UBDs nutzen dies aus, indem sie kleine Spacer zwischen Ubiquitin-wechselwirkenden Motiven, die Lysin-48-verknüpfte Ketten binden (kompakte Ubiquitin-Ketten) und größere Spacer für Lysin-63-verknüpfte Ketten haben. Die an der Erkennung von Polyubiquitinketten beteiligte Maschinerie kann auch zwischen K63-verknüpften Ketten und M1-verknüpften Ketten unterscheiden, was durch die Tatsache belegt wird, dass letztere den proteasomalen Abbau des Substrats induzieren können. [8] [10] [70]

Das Ubiquitinierungssystem funktioniert in einer Vielzahl von zellulären Prozessen, einschließlich: [73]

Membranproteine ​​Bearbeiten

Multimonoubiquitinierung kann Transmembranproteine ​​(z. B. Rezeptoren) für die Entfernung von Membranen (Internalisierung) markieren und mehrere Signalfunktionen innerhalb der Zelle erfüllen. Wenn Transmembranmoleküle auf der Zelloberfläche mit Ubiquitin markiert werden, wird die subzelluläre Lokalisation des Proteins verändert, wobei das Protein häufig zur Zerstörung in Lysosomen anvisiert wird. Dies dient als negativer Rückkopplungsmechanismus, da oft die Stimulation von Rezeptoren durch Liganden deren Ubiquitinierungs- und Internalisierungsrate erhöht. Wie die Monoubiquitinierung spielen auch Lysin-63-verknüpfte Polyubiquitinketten eine Rolle beim Transport einiger Membranproteine. [10] [62] [65] [75]

Fougaro-System Bearbeiten

Das Fougaro-System (griechisch Fougaro, Schornstein) ist ein Sub-Organellen-System im Zellkern, das ein Mechanismus zum Recyceln oder Entfernen von Molekülen aus der Zelle in das externe Medium sein kann. Die Moleküle oder Peptide werden ubiquitiniert, bevor sie aus dem Zellkern freigesetzt werden. Die ubiquitinierten Moleküle werden unabhängig oder in Verbindung mit endosomalen Proteinen wie Beclin freigesetzt. [76]

Genomische Wartung Bearbeiten

Proliferating Cell Nuclear Antigen (PCNA) ist ein Protein, das an der DNA-Synthese beteiligt ist. Unter normalen physiologischen Bedingungen wird PCNA sumoyliert (eine ähnliche posttranslationale Modifikation wie die Ubiquitinierung). Wenn die DNA durch ultraviolette Strahlung oder Chemikalien beschädigt wird, wird das SUMO-Molekül, das an einen Lysinrest gebunden ist, durch Ubiquitin ersetzt. Monoubiquitinierte PCNA rekrutiert Polymerasen, die eine DNA-Synthese mit beschädigter DNA durchführen können, was jedoch sehr fehleranfällig ist und möglicherweise zur Synthese mutierter DNA führt. Die Lysin-63-verknüpfte Polyubiquitinierung von PCNA ermöglicht es, einen weniger fehleranfälligen Mutations-Bypass durchzuführen, der durch den Template-Switching-Weg bekannt ist. [6] [77] [78]

Die Ubiquitinierung von Histon H2AX ist an der DNA-Schädigungserkennung von DNA-Doppelstrangbrüchen beteiligt. Lysin-63-verknüpfte Polyubiquitinketten werden auf H2AX-Histon durch das E2/E3-Ligasepaar Ubc13-Mms2/RNF168 gebildet. [79] [80] Diese K63-Kette scheint RAP80 zu rekrutieren, das ein UIM enthält, und RAP80 hilft dann bei der Lokalisierung von BRCA1. Dieser Weg wird schließlich die notwendigen Proteine ​​für die homologe Rekombinationsreparatur rekrutieren. [81]

Transkriptionsregulierung Bearbeiten

Histone können ubiquitiniert werden und dies geschieht normalerweise in Form einer Monoubiquitinierung (obwohl polyubiquitinierte Formen vorkommen). Die Histon-Ubiquitinierung verändert die Chromatinstruktur und ermöglicht den Zugang von Enzymen, die an der Transkription beteiligt sind. Ubiquitin auf Histone wirkt auch als Bindungsstelle für Proteine, die die Transkription entweder aktivieren oder hemmen und kann auch weitere posttranslationale Modifikationen des Proteins induzieren. Diese Effekte können alle die Transkription von Genen modulieren. [82] [83]

Deubiquitinierende Enzyme (DUBs) wirken der Rolle der Ubiquinierung entgegen, indem sie Ubiquitin aus Substratproteinen entfernen. Sie sind Cystein-Proteasen, die die Amidbindung zwischen den beiden Proteinen spalten. Sie sind hochspezifisch, ebenso wie die E3-Ligasen, die das Ubiquitin anlagern, mit nur wenigen Substraten pro Enzym. Sie können sowohl Isopeptide (zwischen Ubiquitin und Lysin) als auch Peptidbindungen (zwischen Ubiquitin und dem N-Terminus) spalten. Neben der Entfernung von Ubiquitin aus Substratproteinen haben DUBs viele andere Funktionen innerhalb der Zelle. Ubiquitin wird entweder als mehrere Kopien exprimiert, die zu einer Kette verbunden sind (Polyubiquitin) oder an ribosomale Untereinheiten gebunden sind. DUBs spalten diese Proteine, um aktives Ubiquitin zu produzieren. Sie recyceln auch Ubiquitin, das während des Ubiquitinierungsprozesses an kleine nukleophile Moleküle gebunden wurde. Monoubiquitin wird von DUBs gebildet, die Ubiquitin von freien Polyubiquitinketten abspalten, die zuvor von Proteinen entfernt wurden. [84] [85]

Ubiquitin-bindende Domänen (UBDs) sind modulare Proteindomänen, die nicht-kovalent an Ubiquitin binden. Diese Motive steuern verschiedene zelluläre Ereignisse. Für eine Reihe von UBDs sind detaillierte molekulare Strukturen bekannt, die Bindungsspezifität bestimmt ihren Wirk- und Regulationsmechanismus und wie sie zelluläre Proteine ​​und Prozesse reguliert. [86] [87]

Pathogenese Bearbeiten

Der Ubiquitin-Signalweg ist an der Pathogenese einer Vielzahl von Krankheiten und Störungen beteiligt, darunter: [88]

Neurodegeneration Bearbeiten

Ubiquitin ist an neurodegenerativen Erkrankungen im Zusammenhang mit Proteostase-Dysfunktion beteiligt, einschließlich Alzheimer-Krankheit, Motoneuron-Krankheit, [89] Huntington-Krankheit und Parkinson-Krankheit. [90] Transkriptvarianten, die verschiedene Isoformen von Ubiquilin-1 kodieren, werden in Läsionen gefunden, die mit der Alzheimer- und Parkinson-Krankheit assoziiert sind. [91] Es wurde gezeigt, dass höhere Ubiquilinspiegel im Gehirn die Fehlbildung des Amyloid-Vorläuferproteins (APP) verringern, das eine Schlüsselrolle bei der Auslösung der Alzheimer-Krankheit spielt. [92] Umgekehrt wurden niedrigere Ubiquilin-1-Spiegel im Gehirn mit einer erhöhten Fehlbildung von APP in Verbindung gebracht. [92] Eine Frameshift-Mutation in Ubiquitin B kann dazu führen, dass einem verkürzten Peptid das C-terminale Glycin fehlt. Dieses abnormale Peptid, bekannt als UBB+1, akkumuliert selektiv bei der Alzheimer-Krankheit und anderen Tauopathien.

Infektion und Immunität Bearbeiten

Ubiquitin und Ubiquitin-ähnliche Moleküle regulieren die Signaltransduktionswege des Immunsystems in praktisch allen Stadien umfassend, einschließlich der Steady-State-Repression, der Aktivierung während der Infektion und der Abschwächung nach der Clearance. Ohne diese Regulation kann die Immunaktivierung gegen Krankheitserreger fehlerhaft sein, was zu einer chronischen Erkrankung oder zum Tod führt. Alternativ kann das Immunsystem hyperaktiviert werden und Organe und Gewebe können Autoimmunschäden ausgesetzt sein.

Auf der anderen Seite müssen Viren Wirtszellprozesse blockieren oder umleiten, einschließlich der Immunität, um sich effektiv zu replizieren, dennoch haben viele Viren, die für Krankheiten relevant sind, informationell begrenzte Genome. Aufgrund seiner sehr vielen Rollen in der Zelle stellt die Manipulation des Ubiquitin-Systems für solche Viren eine effiziente Möglichkeit dar, kritische Wirtszellprozesse zu blockieren, zu unterlaufen oder umzuleiten, um ihre eigene Replikation zu unterstützen. [93]

Das Retinsäure-induzierbare Gen I (RIG-I) Protein ist ein primärer Immunsystemsensor für virale und andere invasive RNA in menschlichen Zellen. [94] Der RIG-I-like-Rezeptor (RLR)-Immunsignalweg ist einer der am umfassendsten untersuchten im Hinblick auf die Rolle von Ubiquitin bei der Immunregulation. [95]

Genetische Störungen Bearbeiten

    wird durch eine Störung der UBE3A, das ein Ubiquitin-Ligase (E3)-Enzym kodiert, das als E6-AP bezeichnet wird. die Zerstörung einer Ubiquitin-E3-Ligase, die als VHL-Tumorsuppressor bezeichnet wird, beinhaltet, oder VHL Gen. : Acht der dreizehn identifizierten Gene, deren Störung diese Krankheit verursachen kann, kodieren für Proteine, die einen großen Ubiquitin-Ligase-(E3)-Komplex bilden. ist eine autosomal-rezessive Wachstumsverzögerungsstörung, die mit Mutationen der Cullin7-E3-Ubiquitin-Ligase einhergeht. [96]

Diagnostische Verwendung Bearbeiten

Immunhistochemie mit Antikörpern gegen Ubiquitin kann abnormale Ansammlungen dieses Proteins in Zellen identifizieren, die auf einen Krankheitsprozess hinweisen. Diese Proteinansammlungen werden als Einschlusskörperchen bezeichnet (was ein allgemeiner Begriff für jede mikroskopisch sichtbare Ansammlung von abnormalem Material in einer Zelle ist). Beispiele beinhalten:

Link zu Krebs Bearbeiten

Die posttranslationale Modifikation von Proteinen ist ein allgemein verwendeter Mechanismus bei der Signalübertragung von eukaryotischen Zellen. [97] Ubiquitinierung oder Ubiquitin-Konjugation an Proteine ​​ist ein entscheidender Prozess für die Zellzyklusprogression und die Zellproliferation und -entwicklung. Obwohl die Ubiquitinierung normalerweise als Signal für den Proteinabbau durch das 26S-Proteasom dient, könnte sie auch für andere grundlegende zelluläre Prozesse dienen, [97] z. bei Endozytose [98] enzymatische Aktivierung [99] und DNA-Reparatur. [100] Da die Ubiquitinierung die zelluläre Ebene von Cyclinen stark reguliert, wird darüber hinaus erwartet, dass ihre Fehlregulation schwerwiegende Auswirkungen hat. Erste Hinweise auf die Bedeutung des Ubiquitin/Proteasom-Signalwegs bei onkogenen Prozessen wurden aufgrund der hohen Antitumoraktivität von Proteasom-Inhibitoren beobachtet. [101] [102] [103] Verschiedene Studien haben gezeigt, dass Defekte oder Veränderungen in Ubiquitinierungsprozessen häufig mit humanen Karzinomen assoziiert oder vorhanden sind. [104] [105] [106] [107] [108] [109] [110] [111] Maligne Erkrankungen könnten durch Funktionsverlustmutation direkt am Tumorsuppressorgen, erhöhte Ubiquitinierungsaktivität und/oder indirekte Attenuierung entstehen der Ubiquitinierung aufgrund von Mutationen in verwandten Proteinen. [112]

Direkter Funktionsverlust Mutation der E3-Ubiquitin-Ligase Bearbeiten

Nierenzellkarzinom Bearbeiten

Das VHL-Gen (Von Hippel-Lindau) kodiert für einen Bestandteil einer E3-Ubiquitin-Ligase. Der VHL-Komplex zielt auf ein Mitglied der Hypoxie-induzierbaren Transkriptionsfaktorfamilie (HIF) zum Abbau ab, indem er unter normoxischen Bedingungen mit der sauerstoffabhängigen Zerstörungsdomäne interagiert. HIF aktiviert nachgeschaltete Ziele wie den vaskulären endothelialen Wachstumsfaktor (VEGF) und fördert so die Angiogenese. Mutationen im VHL verhindern den Abbau von HIF und führen so zur Bildung von hypervaskulären Läsionen und Nierentumoren. [104] [112]

Brustkrebs Bearbeiten

Die BRCA1 Gen ist ein weiteres Tumorsuppressorgen beim Menschen, das für das BRCA1-Protein kodiert, das an der Reaktion auf DNA-Schäden beteiligt ist. Das Protein enthält ein RING-Motiv mit E3-Ubiquitin-Ligase-Aktivität. BRCA1 könnte aufgrund seiner Ubiquitinierungsaktivität mit anderen Molekülen wie BARD1 und BAP1 ein Dimer bilden. Mutationen, die die Ligasefunktion beeinträchtigen, werden häufig gefunden und mit verschiedenen Krebsarten in Verbindung gebracht. [108] [112]

Cyclin E Bearbeiten

Da Prozesse in der Zellzyklusprogression die grundlegendsten Prozesse für das Zellwachstum und die Zelldifferenzierung sind und bei menschlichen Karzinomen am häufigsten verändert werden, wird erwartet, dass Zellzyklus-regulierende Proteine ​​einer strengen Regulierung unterliegen. Der Cyclinspiegel ist, wie der Name schon sagt, nur zu einem bestimmten Zeitpunkt während des Zellzyklus hoch. Dies wird durch die kontinuierliche Kontrolle der Cycline/CDKs-Spiegel durch Ubiquitinierung und Abbau erreicht. Wenn Cyclin E mit CDK2 verpartnert und phosphoryliert wird, erkennt ein SCF-assoziiertes F-Box-Protein Fbw7 den Komplex und zielt damit auf den Abbau ab. Mutationen in Fbw7 wurden in mehr als 30% der menschlichen Tumoren gefunden, was es als Tumorsuppressorprotein charakterisiert. [111]

Erhöhte Ubiquitinierungsaktivität Bearbeiten

Gebärmutterhalskrebs Bearbeiten

Onkogene Typen des humanen Papillomavirus (HPV) sind dafür bekannt, den zellulären Ubiquitin-Proteasom-Weg für eine Virusinfektion und -replikation zu kapern. Die E6-Proteine ​​von HPV binden an den N-Terminus der zellulären E6-AP E3-Ubiquitin-Ligase und leiten den Komplex um, um p53 zu binden, ein bekanntes Tumorsuppressorgen, dessen Inaktivierung bei vielen Krebsarten vorkommt. [106] p53 erfährt daher eine Ubiquitinierung und einen proteasomvermittelten Abbau. In der Zwischenzeit wird E7, ein weiteres der früh exprimierten HPV-Gene, an Rb, ebenfalls ein Tumorsuppressorgen, binden und dessen Abbau vermitteln. [112] Der Verlust von p53 und Rb in Zellen ermöglicht eine grenzenlose Zellproliferation.

P53-Regelung Bearbeiten

Genamplifikation tritt häufig in verschiedenen Tumorfällen auf, einschließlich von MDM2kodiert ein Gen für eine RING E3 Ubiquitin-Ligase, die für die Herunterregulierung der p53-Aktivität verantwortlich ist. MDM2 zielt auf p53 für die Ubiquitinierung und den proteasomalen Abbau ab, wodurch sein Niveau für den normalen Zellzustand angemessen gehalten wird. Die Überexpression von MDM2 führt zu einem Verlust der p53-Aktivität und ermöglicht daher den Zellen ein grenzenloses Replikationspotential. [107] [112]

S. 27 Bearbeiten

Ein weiteres Gen, das ein Ziel der Genamplifikation ist, ist SKP2. SKP2 ist ein F-Box-Protein, das bei der Substraterkennung für Ubiquitinierung und Abbau eine Rolle spielt. SKP2 zielt auf p27 Kip-1 ab, einen Inhibitor von Cyclin-abhängigen Kinasen (CDKs). CDKs2/4 kooperieren mit der cyclinsE/D-Familie, der Familie der Zellzyklusregulatoren, um das Fortschreiten des Zellzyklus durch die G1-Phase zu kontrollieren. Ein niedriger Spiegel des p27 Kip-1-Proteins wird häufig bei verschiedenen Krebsarten gefunden und ist auf eine Überaktivierung der Ubiquitin-vermittelten Proteolyse durch Überexpression von SKP2 zurückzuführen. [109] [112]

EFP Bearbeiten

Efp oder Östrogen-induzierbares RING-Finger-Protein ist eine E3-Ubiquitin-Ligase, deren Überexpression nachweislich die Hauptursache für Östrogen-unabhängigen Brustkrebs ist. [103] [113] Das Substrat von Efp ist 14-3-3-Protein, das den Zellzyklus negativ reguliert.

Umgehung der Ubiquitination Bearbeiten

Darmkrebs Bearbeiten

Das mit Darmkrebs assoziierte Gen ist die adenomatöse Polyposis coli (APC), ein klassisches Tumorsuppressorgen. Das APC-Genprodukt zielt auf Beta-Catenin für den Abbau über Ubiquitinierung am N-Terminus ab und reguliert so dessen zelluläres Niveau. Die meisten Fälle von Darmkrebs werden mit Mutationen im APC-Gen gefunden. In Fällen, in denen das APC-Gen jedoch nicht mutiert ist, werden Mutationen im N-Terminus von Beta-Catenin gefunden, was es ubiquitinierungsfrei macht und somit die Aktivität erhöht. [105] [112]

Glioblastom Bearbeiten

Als aggressivster Krebs, der vom Gehirn ausgeht, stehen bei Patienten mit Glioblastom gefundene Mutationen im Zusammenhang mit der Deletion eines Teils der extrazellulären Domäne des epidermalen Wachstumsfaktorrezeptors (EGFR). Diese Deletion führt dazu, dass die CBL-E3-Ligase nicht in der Lage ist, den Rezeptor für dessen Recycling und Abbau über einen Ubiquitin-lysosomalen Weg zu binden. Somit ist EGFR in der Zellmembran konstitutiv aktiv und aktiviert seine nachgeschalteten Effektoren, die an der Zellproliferation und -migration beteiligt sind. [110]

Phosphorylierungsabhängige Ubiquitinierung Bearbeiten

Das Wechselspiel zwischen Ubiquitinierung und Phosphorylierung ist ein anhaltendes Forschungsinteresse, da Phosphorylierung oft als Marker dient, wo Ubiquitinierung zum Abbau führt. [97] Darüber hinaus kann die Ubiquitinierung auch die Kinase-Aktivität eines Proteins aktivieren/deaktivieren. [114] Die kritische Rolle der Phosphorylierung wird weitgehend bei der Aktivierung und Aufhebung der Autohemmung im Cbl-Protein unterstrichen. [115] Cbl ist eine E3-Ubiquitin-Ligase mit einer RING-Finger-Domäne, die mit ihrer Tyrosinkinase-Bindungsdomäne (TKB) interagiert und die Interaktion der RING-Domäne mit einem E2-Ubiquitin-konjugierenden Enzym verhindert. Diese intramolekulare Interaktion ist eine Autohemmungsregulation, die ihre Rolle als negativer Regulator verschiedener Wachstumsfaktoren und der Tyrosinkinase-Signalgebung und T-Zell-Aktivierung verhindert. [115] Die Phosphorylierung von Y363 lindert die Autohemmung und verstärkt die Bindung an E2. [115] Mutationen, die das Cbl-Protein aufgrund des Verlusts seiner Ligase-/Tumorsuppressorfunktion und der Aufrechterhaltung seiner positiven Signalübertragungs-/onkogenen Funktion dysfunktional machen, verursachen nachweislich die Entstehung von Krebs. [116] [117]

Als Drogenziel Bearbeiten

Screening auf Ubiquitin-Ligase-Substrate Bearbeiten

Die Identifizierung von E3-Ligase-Substraten ist entscheidend, um ihre Implikationen bei menschlichen Krankheiten zu verstehen, da die Deregulierung von E3-Substrat-Wechselwirkungen oft als Hauptursache für viele dient. Um die Beschränkung des Mechanismus zur Identifizierung der Substrate der E3-Ubiquitin-Ligase zu überwinden, wurde 2008 ein System namens „Global Protein Stability (GPS) Profiling“ entwickelt. [118] Dieses Hochdurchsatzsystem nutzte Reporterproteine, die mit Tausende potenzieller Substrate unabhängig voneinander. Durch die Hemmung der Ligase-Aktivität (durch die Bildung von Cul1 dominant negativ wird somit eine Ubiquitinierung verhindert) zeigt eine erhöhte Reporteraktivität, dass die identifizierten Substrate akkumuliert werden. Dieser Ansatz fügte der Liste der E3-Ligase-Substrate eine große Anzahl neuer Substrate hinzu.

Mögliche therapeutische Anwendungen Bearbeiten

Blockierung der spezifischen Substraterkennung durch die E3-Ligasen, z.B. Bortezomib. [113]

Herausforderung Bearbeiten

Das Auffinden eines spezifischen Moleküls, das selektiv die Aktivität einer bestimmten E3-Ligase und/oder die an der Krankheit beteiligten Protein-Protein-Interaktionen hemmt, bleibt eines der wichtigen und expandierenden Forschungsgebiete. Da die Ubiquitinierung zudem ein mehrstufiger Prozess mit verschiedenen Akteuren und Zwischenformen ist, muss die Berücksichtigung der sehr komplexen Wechselwirkungen zwischen den Komponenten beim Design der niedermolekularen Inhibitoren stark berücksichtigt werden. [103]

Obwohl Ubiquitin der am meisten verstandene Post-Translation-Modifikator ist, gibt es eine wachsende Familie von Ubiquitin-ähnlichen Proteinen (UBLs), die zelluläre Ziele auf einem Weg modifizieren, der parallel zu dem von Ubiquitin verläuft, sich jedoch von ihm unterscheidet. Zu den bekannten UBLs gehören: kleiner Ubiquitin-ähnlicher Modifikator (SUMO), Ubiquitin-kreuzreaktives Protein (UCRP, auch bekannt als Interferon-stimuliertes Gen-15 ISG15), Ubiquitin-verwandter Modifikator-1 (URM1), neuronal-precursor-cell-expressed entwicklungsbedingt herunterreguliertes Protein-8 (NEDD8, auch Rub1 in . genannt) S. cerevisiae), humanes Leukozyten-Antigen F-assoziiert (FAT10), Autophagie-8 (ATG8) und -12 (ATG12), wenige Ubiquitin-ähnliche Proteine ​​(FUB1), MUB (membrane-anchored UBL), [119] Ubiquitin-Fold-Modifier- 1 (UFM1) und Ubiquitin-like protein-5 (UBL5, das aber als homolog zu Ubiquitin-1 bekannt ist [Hub1] in S. pombe). [120] [121] Obwohl diese Proteine ​​nur eine geringe Primärsequenzidentität mit Ubiquitin haben, sind sie dreidimensional eng verwandt. SUMO teilt zum Beispiel nur 18% Sequenzidentität, aber sie enthalten die gleiche strukturelle Faltung. Diese Faltung wird "Ubiquitin-Falte" genannt. FAT10 und UCRP enthalten zwei. Diese kompakte globuläre Beta-Griff-Falte findet sich in Ubiquitin, UBLs und Proteinen, die eine Ubiquitin-ähnliche Domäne umfassen, z. das S. cerevisiae Das Spindelpolkörper-Duplikationsprotein Dsk2 und das NER-Protein Rad23 enthalten beide N-terminale Ubiquitindomänen.

Diese verwandten Moleküle haben neue Funktionen und beeinflussen verschiedene biologische Prozesse. Es gibt auch eine Kreuzregulation zwischen den verschiedenen Konjugationswegen, da einige Proteine ​​durch mehr als einen UBL und manchmal sogar am gleichen Lysinrest modifiziert werden können. Beispielsweise wirkt die SUMO-Modifikation oft antagonistisch zur Ubiquitinierung und dient der Stabilisierung von Proteinsubstraten. An UBLs konjugierte Proteine ​​werden typischerweise nicht für den Abbau durch das Proteasom bestimmt, sondern fungieren eher in verschiedenen regulatorischen Aktivitäten. Die Anheftung von UBLs könnte die Substratkonformation verändern, die Affinität für Liganden oder andere interagierende Moleküle beeinflussen, die Substratlokalisierung verändern und die Proteinstabilität beeinflussen.

UBLs sind Ubiquitin strukturell ähnlich und werden durch enzymatische Schritte, die den entsprechenden Mechanismen für Ubiquitin ähneln, verarbeitet, aktiviert, konjugiert und aus Konjugaten freigesetzt. UBLs werden auch mit C-terminalen Erweiterungen übersetzt, die verarbeitet werden, um das invariante C-terminale LRGG zu exponieren. Diese Modifikatoren haben ihre eigenen spezifischen E1-(aktivierenden), E2-(konjugierenden) und E3-(ligierenden) Enzyme, die die UBLs an intrazelluläre Ziele konjugieren. Diese Konjugate können durch UBL-spezifische Isopeptidasen, die ähnliche Mechanismen wie die deubiquitinierenden Enzyme haben, rückgängig gemacht werden. [73]

Bei einigen Arten ist die Erkennung und Zerstörung der Spermienmitochondrien durch einen Mechanismus mit Ubiquitin für die Entsorgung der Spermienmitochondrien nach der Befruchtung verantwortlich. [122]

Prokaryotische Ursprünge Bearbeiten

Es wird angenommen, dass Ubiquitin von bakteriellen Proteinen abstammt, die ThiS (O32583) [123] oder MoaD (P30748) ähnlich sind. [124] Diese prokaryotischen Proteine ​​haben trotz geringer Sequenzidentität (ThiS hat 14% Identität zu Ubiquitin) die gleiche Proteinfaltung. Diese Proteine ​​teilen auch die Schwefelchemie mit Ubiquitin. MoaD, das an der Molybdopterin-Biosynthese beteiligt ist, interagiert mit MoeB, das wie ein E1-Ubiquitin-aktivierendes Enzym für MoaD wirkt und die Verbindung zwischen diesen prokaryotischen Proteinen und dem Ubiquitin-System stärkt. Ein ähnliches System existiert für ThiS mit seinem E1-ähnlichen Enzym ThiF. Es wird auch angenommen, dass die Saccharomyces cerevisiae Protein Urm-1, ein Ubiquitin-verwandter Modifikator, ist ein "molekulares Fossil", das die evolutionäre Beziehung mit den prokaryotischen Ubiquitin-ähnlichen Molekülen und Ubiquitin verbindet. [125]

Archaea haben ein funktionell engeres Homolog des Ubiquitin-Modifikationssystems, bei dem eine "Sampylierung" mit SAMPs (Small Archaeal Modifier Proteins) durchgeführt wird. Das Probenahmesystem verwendet E1 nur, um Proteine ​​zum Proteosom zu führen. [126] Proteoarchaeota, die mit den Vorfahren der Eukaryoten verwandt sind, besitzen alle E1-, E2- und E3-Enzyme sowie ein reguliertes Rpn11-System. Im Gegensatz zu SAMP, die ThiS oder MoaD ähnlicher sind, sind Proteoarchaeota-Ubiquitin eukaryontischen Homologen am ähnlichsten. [127]

Prokaryotisches Ubiquitin-ähnliches Protein (Pup) ist ein funktionelles Analogon von Ubiquitin, das im grampositiven Bakterienstamm Actinobacteria gefunden wurde. Es hat dieselbe Funktion (Zielproteine ​​für den Abbau), obwohl die Enzymologie der Ubiquitinierung und Pupylierung unterschiedlich ist und die beiden Familien keine Homologie aufweisen. Im Gegensatz zur dreistufigen Reaktion der Ubiquitinierung erfordert die Pupylierung zwei Schritte, daher sind nur zwei Enzyme an der Pupylierung beteiligt.

Im Jahr 2017 wurden Homologe von Pup in fünf Stämmen gramnegativer Bakterien, in sieben Bakterienstämmen der Kandidaten und in einem Archaeon berichtet [128] Die Sequenzen der Pup-Homologen unterscheiden sich stark von den Sequenzen von Pup in grampositiven Bakterien und waren als Ubiquitin-Bakterien (UBact) bezeichnet, obwohl die Unterscheidung noch nicht durch einen separaten evolutionären Ursprung phylogenetisch gestützt und ohne experimentelle Beweise nachgewiesen wurde. [128]

Der Befund des Pup/UBact-Proteasom-Systems in grampositiven und gramnegativen Bakterien legt nahe, dass sich entweder das Pup/UBact-Proteasom-System in Bakterien vor der Aufspaltung in grampositive und -negative Kladen vor über 3000 Millionen Jahren entwickelt hat oder [129] dass diese Systeme von verschiedenen Bakterienstämmen durch horizontalen Gentransfer von einem dritten, noch unbekannten Organismus erworben wurden. Zur Unterstützung der zweiten Möglichkeit, zwei UBakt Loci wurden im Genom eines unkultivierten anaeroben methanotrophen Archaeons (ANME-1locus CBH38808.1 und Locus CBH39258.1) gefunden.


Informationen zum Autor

Derzeitige Anschrift: Derzeitige Anschrift: Institut für Naturstofftechnik, TU Dresden, 01062 Dresden, Deutschland,

Gegenwärtige Anschrift: Gegenwärtige Anschrift: CEMES-CNRS, 29 Rue Jeanne Marvig, F-31055 Toulouse, Frankreich,

Mitgliedschaften

LISBP, Université de Toulouse, CNRS, INRA, INSA, Toulouse, Frankreich, Avenue de Rangueil 135, Toulouse, F-31077, Frankreich

Thomas Walther, Christopher M. Topham, Romain Irague, Clément Auriol, Audrey Baylac, Clémentine Dressaire, Luce Lozano-Huguet, Nathalie Tarrat, Nelly Martineau, Marion Stodel, Yannick Malbert, Isabelle André, Magali Remaud-Siméon & Jean Marie François

TWB, 3 rue des Satellites, Canal Biotech Building 2, Toulouse, F-31400, Frankreich

Thomas Walther, Clément Auriol, Hélène Cordier, Clémentine Dressaire, Yannick Malbert, Isabelle André, Magali Remaud-Siméon und Jean Marie François

Adisseo SA, Antony Parc II, 10 Place General de Gaulle, Antony, F-92160, Frankreich


Schau das Video: Amino acid catabolism Transamination. Deamination. Urea cycle (Kann 2022).