Information

Was ist der Unterschied zwischen Protein- und DNA-Verhalten während der Agarosegel-Elektrophorese?

Was ist der Unterschied zwischen Protein- und DNA-Verhalten während der Agarosegel-Elektrophorese?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Ich plane ein wissenschaftliches Projekt über Gelelektrophorese und würde gerne wissen, ob es welche gibt messbar, quantifizierbar (zum Beispiel Dinge, die ich in einem Diagramm oder Diagramm darstellen könnte) Unterschiede zwischen dem Verhalten von Protein und DNA während der Agarosegelelektrophorese. Detaillierte Eingaben und nützliche Links werden sehr geschätzt.


Es gibt zwei wichtige Eigenschaften, die bestimmen, wie sich ein Molekül während der Gelelektrophorese bewegt:

  • Größe und Form des Moleküls
  • Ladung des Moleküls

Sie legen ein elektrisches Feld an und alle Moleküle bewegen sich entsprechend ihrer Ladung. Das Gel selbst behindert die Bewegung größerer Moleküle. Dies bedeutet, dass sich kleine Moleküle weiter bewegen als große Moleküle.

Nukleinsäuren wie RNA und DNA haben eine einheitliche negative Ladung vom Phosphatrückgrat. Dies bedeutet, dass sie sich im Allgemeinen nach ihrer Größe und Form trennen (Plasmide können in verschiedenen Formen vorliegen, z. B. supercoiled, kreisförmig oder linearisiert).

Proteine ​​haben unterschiedliche Ladungen, einige haben eine positive Ladung bei dem typischerweise für die Gelelektrophorese verwendeten pH, einige haben eine negative Ladung und einige haben bei diesem pH keine Ladung. Wenn Sie also einfach Proteine ​​auf einem Gel laufen lassen würden, würden sich einige rückwärts bewegen, einige vorwärts und einige überhaupt nicht.

Um die Proteine ​​nach ihrer Größe zu trennen, verwenden wir das Detergens SDS, um die Proteine ​​zu denaturieren und ihnen eine einheitliche Ladung zu verleihen (SDS ist negativ geladen). Proteine ​​werden auch auf Polyacrylamidgelen und nicht auf Agarose geführt, da die Größe der Poren in Agarose schlecht zu der typischen Größe von Proteinen passt.

Obwohl ich noch nie jemanden gesehen habe, der Agarose für Proteine ​​​​verwendet, scheint es möglich zu sein und manchmal für größere Proteine ​​​​verwendet zu werden. Ich fand ein Papier, das ein Protokoll beschreibt, in dem sehr hohe Konzentrationen von Agarose im Bereich von 4-5% verwendet wurden. Ich vermute, dass sie nicht gut damit umgehen werden, aber das sollten Sie selbst ausprobieren. Wenn die Proteine, die Sie untersuchen, etwas größer sind, sollte die Verwendung von Agarose möglich sein.


Unterschied zwischen SDS PAGE und Gelelektrophorese

Elektrophorese kann verwendet werden, um die Masse eines Objekts gewöhnlich für Protein und Desoxyribonukleinsäure (DNA) zu bestimmen. Der DNA-Strang kann, wenn er in Chemikalien eingeführt wird, den Informationsprozess beschleunigen oder verlangsamen. DNA-Marker bekannter Masse werden verwendet, um die Größe der sich bewegenden Objekte nach Beendigung der Elektrophorese abzuschätzen. Die Elektrophorese ist wahrscheinlich das am häufigsten verwendete Werkzeug für Molekularbiologen und Biochemiker.

Es gibt zwei Arten von Elektrophorese, die üblicherweise in diesem Verfahren verwendet werden. Diese sind Natriumdodecylsulfat-Polyacrylamid-Gelelektrophorese (SDS-PAGE) und native Gelelektrophorese.

SDS-PAGE ist eine nicht-selektive Methode der Gelelektrophorese, die in Bereichen wie: Biochemie, Forensik, Biologie und Genetik verwendet wird, um Proteine ​​von ihrer elektrophoretischen Mobilität zu lösen. SDS ist ein anionisches Tensid, das zur Unterstützung der Lyse von Zellen während der DNA-Extraktion und zur Trennung von Proteinen in SDS-PAGE verwendet werden kann. Bei der Elektrophorese wird zunächst ein Proteingemisch in einer SDS-Lösung verflüssigt. Dann wird eine Substanz namens Mercaptoeethanol aufgetragen, um Disulfidbindungen zu entfernen und das Protein linear zu machen. Dann wird die Elektrophorese eingeleitet. Die Ergebnisse würden zwei Molekülreste ergeben, von denen einer SDS-PAGE ist.

Das Fehlen von SDS-PAGE ist kein Problem, da Gelelektrophorese immer noch durchgeführt werden kann, nur dass Proteine ​​nicht ihre gesamte Sekundär- und Tertiärstruktur verlieren und sich nicht in im Allgemeinen geraden Stäbchen öffnen.

Inzwischen verwendet die native Gelelektrophorese Gel als antikonvektives Medium. Es wird normalerweise zur Trennung von biologischen Makromolekülen wie DNA, Ribonukleinsäure (RNA) und Protein verwendet. Es kann auch zur Abtrennung von Nanopartikeln verwendet werden.

Es gibt zwei Hauptgele, die bei der nativen Gelelektrophorese verwendet werden, nämlich:

Agarosegel, das für größere Moleküle verwendet wird. Dieses Gel identifiziert keine kleinen Unterschiede zwischen zwei Molekülbanden. Es wird auch ausschließlich zur Trennung von DNA verwendet. Die Visualisierung des Agarosegels erfolgt mit der Ethidiumbromid-Mischung.

Polyacrylamidgel, das für kleinere Moleküle verwendet wird. Dieses Gel identifiziert die Unterschiede zwischen molekularen Banden. Neben DNA kann es auch Proteine ​​trennen.

1.SDS-PAGE ist eine nicht-selektive Methode der Gelelektrophorese, die in Bereichen wie: Biochemie, Forensik, Biologie und Genetik verwendet wird, um Proteine ​​von ihrer elektrophoretischen Mobilität zu lösen, während die Gelelektrophorese normalerweise zur Trennung biologischer Makromoleküle wie DNA verwendet wird, Ribonukleinsäure (RNA) und Protein. Es kann auch zur Abtrennung von Nanopartikeln verwendet werden.

2. Native Gelelektrophorese hat zwei Arten, nämlich: Agarosegel und Polyacrylamidgel.


Agarosegelelektrophorese zur Trennung von DNA-Fragmenten

Die Agarose-Gelelektrophorese ist die effektivste Methode zur Trennung von DNA-Fragmenten unterschiedlicher Größe im Bereich von 100 bp bis 25 kb(1). Agarose wird aus den Algengattungen Gelidium und Gracilaria isoliert und besteht aus wiederholten Agarobiose-Untereinheiten (L- und D-Galactose)(2). Während der Gelierung assoziieren Agarosepolymere nicht-kovalent und bilden ein Netzwerk von Bündeln, deren Porengrößen die Molekularsiebeigenschaften eines Gels bestimmen. Die Anwendung der Agarosegelelektrophorese revolutionierte die Trennung von DNA. Vor der Einführung von Agarosegelen wurde die DNA hauptsächlich durch Saccharose-Dichtegradientenzentrifugation getrennt, die nur eine ungefähre Größe lieferte. Um DNA mittels Agarosegelelektrophorese zu trennen, wird die DNA in vorgegossene Vertiefungen im Gel geladen und ein Strom angelegt. Das Phosphat-Rückgrat des DNA- (und RNA-) Moleküls ist negativ geladen, daher wandern DNA-Fragmente in ein elektrisches Feld zur positiv geladenen Anode. Da DNA ein einheitliches Masse/Ladungs-Verhältnis hat, werden DNA-Moleküle nach Größe innerhalb eines Agarosegels in einem Muster getrennt, so dass die zurückgelegte Strecke umgekehrt proportional zum Logarithmus ihres Molekulargewichts ist (3). Das führende Modell für die DNA-Bewegung durch ein Agarosegel ist die "voreingenommene Reptation", bei der sich die Vorderkante nach vorne bewegt und den Rest des Moleküls mitzieht(4). Die Migrationsgeschwindigkeit eines DNA-Moleküls durch ein Gel wird durch Folgendes bestimmt: 1) Größe des DNA-Moleküls 2) Agarosekonzentration 3) DNA-Konformation(5) 4) angelegte Spannung, 5) Vorhandensein von Ethidiumbromid, 6) Art des Agarose und 7) Elektrophoresepuffer. Nach der Trennung können die DNA-Moleküle nach Färbung mit einem geeigneten Farbstoff unter UV-Licht sichtbar gemacht werden. Durch Befolgen dieses Protokolls sollten die Schüler in der Lage sein: den Mechanismus zu verstehen, durch den DNA-Fragmente in einer Gelmatrix getrennt werden Verstehen, wie die Konformation des DNA-Moleküls seine Mobilität durch eine Gelmatrix bestimmt Eine Agaroselösung mit geeigneter Konzentration für ihre Bedürfnisse zu identifizieren Vorbereiten ein Agarosegel für die Elektrophorese von DNA-Proben Aufbau des Gelelektrophorese-Geräts und der Stromversorgung Wählen Sie eine geeignete Spannung für die Trennung von DNA-Fragmenten. Verstehen Sie den Mechanismus, mit dem Ethidiumbromid die Visualisierung von DNA-Banden ermöglicht.


Wie läuft eine zirkuläre Plasmid-DNA während der Gelelektrophorese ab?

Die Gelelektrophoresebedingungen (einschließlich der Anwesenheit von Ethidiumbromid, Gelkonzentrationen, elektrische Feldstärke, Temperatur und Ionenstärke des Elektrophoresepuffers) können die Mobilität der Plasmid-DNA beeinflussen. Aufgrund der netzartigen Natur des Agarosegels wird zirkuläre Plasmid-DNA leichter im Agarosegel aufgefangen.

Das elektrophoretische Einfangen ist ein Gleichgewicht zwischen der elektrophoretischen Kraft (die die zirkuläre Plasmid-DNA gegen die Falle zieht) und der Diffusion (die es der zirkulären Plasmid-DNA ermöglicht, einer Falle zu entkommen). Große zirkuläre Moleküle haben also eine größere Chance, gefangen zu werden als kleinere DNA. Supercoiled-DNA ist aufgrund der geringen Größe der verdrillten DNA schwieriger einzufangen.


RESULTATE UND DISKUSSIONEN

Identifizierung und Charakterisierung geeigneter Farbstoffe

In Abb. 1 Spuren N1–N7 stellen negativ geladene (anionische) Farbstoffe dar, die während der Elektrophorese zur Anode (positive Elektrode) wanderten. Spuren P1–P7 stellen positiv geladene (kationische) Farbstoffe dar, die während der Elektrophorese zur Kathode (negative Elektrode) wanderten. Da positiv geladene Farbstoffe in die entgegengesetzte Richtung zur Standard-DNA-Gelelektrophorese wandern, wird das diese Farbstoffe enthaltende Gel so in den Tank gegeben, dass sich die Vertiefungen näher an der Anode statt an der Kathode befinden, so dass die Farbstoffe durch das Gel zur Kathode wandern können.

Migration von Farbstoffen in der Gelelektrophorese. Agarosegel (1%), 1X FSME-Puffer, Elektrophorese bei 100 V für 45 min. Siehe Tabelle I für die Identität der Farbstoffe. Spuren N1–N7 zur Anode gewandert und Bahnen P1–P7 zur Kathode gewandert. Gele wurden für die Migration von Farbstoffen in die entsprechende Richtung orientiert. Balken stellen die von DNA-Fragmenten der angegebenen Größen in Basenpaaren (bp) gewanderte Distanz dar.

Die von jeder Farbstoffbande gewanderte mittlere Distanz ist in Tabelle I tabellarisch aufgeführt. Balken repräsentieren gewanderte Distanzen von DNA-Fragmenten, von 250 Basenpaaren (bp) bis 10.000 bp, einer 1-kb-DNA-Leiter (Promega) unter identischen Bedingungen.

Eine Standardkurve der Migrationsstrecke gegen log10 Die bp-Größe des DNA-Fragments wurde konstruiert und verwendet, um die äquivalente „Größe“ jedes Farbstoffs basierend auf der vom Farbstoff migrierten Distanz abzuschätzen. Beachten Sie, dass die migrierte Distanz an der Vorderkante des Farbstoffs gemessen wird und die Farbstoffmigration von mehreren Faktoren beeinflusst wird, wie z. 2). Daher ist die äquivalente „Größe“ jedes Farbstoffs relativ zu den in Tabelle I aufgeführten linearen DNA-Fragmenten nominell, kann jedoch in Lehrexperimenten verwendet werden, wie später erörtert wird.

Durch Farbstoffe in Agar-Agar-Gelen und Elektrolytlösungen migrierte Distanz.

Beachten Sie, dass die positiv geladenen Farbstoffe in einem elektrischen Feld in die entgegengesetzte Richtung zur DNA wandern. Der Verwirrung oder Missverständnis der Schüler sollte angemessene Aufmerksamkeit gewidmet werden, wenn positiv geladene Farbstoffe verwendet werden müssen, um DNA-Proben in der Gelelektrophorese zu simulieren. Andererseits wandern die negativ geladenen Farbstoffe sauber und reproduzierbar und sind somit idealer Ersatz für DNA-Proben.

Mehrere andere Farbstoffe, Karmin, Phenolrot, Bromkresolgrün und Neutralrot, wurden getestet und es wurde festgestellt, dass sie während der Elektrophorese bei pH 8,0 nicht wandern.

Identifizierung und Charakterisierung geeigneter Elektrolyte

Übliche Laborsalze wurden bis auf 10 mM in Wasser gelöst (siehe Tabelle II). pH und Leitfähigkeit wurden gemessen. Der während der Elektrophorese fließende Strom wurde von der Stromanzeige des Bio-Rad-Netzteils aufgezeichnet. Alle Geräte befanden sich bei einer anfänglichen (Umgebungs-)Temperatur von 22 °C. Der Temperaturanstieg des Elektrolyten im Tank am Ende des Laufs wurde aufgezeichnet.

Elektrolyt Formel Konz. pH Spezifische Leitfähigkeit (μs cm −1 ) Elektrophorese bei 60 V für 60 min
Strombereich (mA) Temperatur erhöhen (°C)
Tris-Borat-EDTA FSME 8.0 620 17–19 2.0
Natriumacetat CH3COONa 10 m M 7.5 702 19–22 2.4
Natriumbicarbonat NaHCO3 10 m M 8.2 767 21–22 2.5
Dinatriumhydrogenphosphat N / A2HPO4 10 m M 8.7 1590 39–59 5.2
Dikaliumhydrogenphosphat K2HPO4 10 m M 8.8 2017 49–66 6.7
Kaliumhydroxid KOH 10 m M 11.6 1860 24–30 3.7

Natriumbicarbonat (10 m M ) ist ein leicht erhältlicher, einfach herzustellender Elektrolyt, der in Bezug auf pH und Leitfähigkeit dem 1X-TBE-Puffer sehr nahe kommt, was ihn zu einer bequemen Alternative für die Gelelektrophorese von Farbstoffen macht. Natriumacetat (10 m M ) ist ebenfalls ein geeigneter Ersatz. Die Phosphatpuffer hatten eine höhere Leitfähigkeit, wodurch höhere Ströme durch den Tank fließen konnten, was gelegentlich zu einer lokalen Erwärmung führte, die Teile der Agargele aufweichte. Verwenden von K2HPO4 und Na2HPO4 bei einer Konzentration zwischen 1 und 5 mM minimierte dieses Problem.

Die Elektrophorese unter Verwendung von Elektrolyten mit einer niedrigeren Leitfähigkeit als 1 × TBE reduzierte den Stromfluss und verlangsamte die Migration der Farbstoffe. Es ist möglich, Elektrolyte mit niedriger Leitfähigkeit bei hohen Spannungen zu verwenden, um die Elektrophorese zu beschleunigen [13, 14]. Dies könnte nützlich sein, wenn die Unterrichtszeit begrenzt ist, wurde jedoch nicht untersucht, da die Verwendung höherer Spannungen spezielle Geräte erfordern würde, die elektrische Gefährdung erhöht und somit für den Unterricht ungeeignet ist.

Andere Elektrolyte wurden ebenfalls getestet, erwiesen sich jedoch als ungeeignet. Kaliumiodid und Natriumthiosulfat erzeugten einen Niederschlag, während Natriumchlorid, das in einigen Protokollen vorgeschlagen wird [6,8], eine hohe Leitfähigkeit aufwies und während der Elektrophorese einen unangenehmen Chlorgeruch entwickelte.

Identifizierung und Charakterisierung geeigneter Farbstoff-Elektrolyt-Kombinationen

Es wurde festgestellt, dass sich einige Farbstoffe im Farbton oder in der Intensität ändern, wenn sie mit bestimmten Elektrolyten gemischt werden. Diese Wechselwirkung wurde systematisch gemessen, indem die Farbstofflösungen mit Elektrolytlösungen gemischt und die Extinktionsänderung bestimmt wurden (siehe Tabelle III). Etwa 50 µl jedes Farbstoffs (seriell auf 0,0125% verdünnt) wurden mit 150 µl Elektrolyt in einer 96-Well-Mikrotiterplatte gemischt. Der Extinktionsunterschied (Differenz der optischen Dichte, dOD1) im Vergleich zu Kontrollproben von 50 µl Farbstoff in 150 µl Wasser wurde aufgezeichnet. Die Extinktionsablesungen für jeden Farbstoff wurden bei der Wellenlänge der Spitzenextinktion in der Kontrollprobe durchgeführt, die aus den Absorptionsspektren der Kontrollproben bestimmt wurde. Alle Ablesungen wurden in einem Bio-Rad Benchmark Plus Mikroplatten-Spektrophotometer durchgeführt.

Farbstoff Wellenlänge der Spitzenabsorption (nm) Extinktionsänderung beim Mischen von Farbstoff mit Elektrolyt
CH3COONa NaHCO3 N / A2HPO4 K2HPO4 KOH
Xylolcyanol FF 520 −0.084 −0.079 +0.009 −0.047 −0.583
Methylrot 460 +0.199 +0.020 +0.036 +0.047 +0.047
Orangenschnaps 464 −0.128 −0.068 −0.167 −0.176 −0.016
Kresol rot 435 −0.237 −0.692 −0.039 −0.603 −0.739
Bromphenolblau 589 +0.224 +0.262 −0.005 −0.253 +0.151
Orange G 475 −0.128 −0.005 +0.026 −0.042 −0.075
Ponceau S 615 −0.006 +0.004 −0.003 −0.013 −0.384
Janusgrün 600 −0.220 −0.151 −0.081 −0.222 −0.394
Strahlendes Grün 625 1.566 1.692 −0.019 1.687 DC
Methylviolett 581 −0.021 +0.182 −0.052 −0.136 1.580
Safranin O 512 −0.072 −0.080 −0.080 −0.009 −0.171
Kristallviolett 589 −0.151 3.178 −0.051 1.585 DC
Pyronin Y(G) 547 −0.177 1.769 −0.094 −0.266 2.193
Methylgrün 632 −0.022 −0.170 −0.071 −0.120 DC
  • "DC" zeigt die Kombination vollständig entfärbt an. Ein negativer dOD-Wert weist auf eine Abnahme der Extinktion des im Elektrolyten gelösten Farbstoffs im Vergleich zum Farbstoff nur in Wasser hin und weist somit auf eine Farbverschiebung oder Abnahme der Farbintensität hin. Umgekehrt kann ein positiver dOD-Wert eine Zunahme der Farbintensität anzeigen. Kursiv gedruckte Zahlen weisen auf eine Abnahme von mehr als 1,0 OD-Einheiten hin.

Im Allgemeinen bleiben die negativ geladenen Farbstoffe in den Ersatzelektrolyten stabil, aber einige positiv geladene Farbstoffe zeigen eine deutliche Abnahme der Extinktion, entsprechend einem Verlust an Farbintensität. Die gesamte Gruppe von sieben positiv geladenen Farbstoffen behielt ihre Farbe nur in Na2HPO4.

Alle Farbstoffe waren stabil, wenn sie in 1X TBE-Puffer verwendet wurden (siehe Fig. 1).

Identifizierung und Charakterisierung geeigneter Elektrolytkombinationen

Die bei der Elektrophorese verwendete Gelplatte sollte geeignete physikalische Eigenschaften ähnlich den etablierten Agarosegel-Formulierungen aufweisen. Gele wurden durch Suspendieren von Agarpulver in 10 mM Elektrolytlösungen bis zu einer Endkonzentration von 1% (Gew./Vol.) hergestellt und in einem Mikrowellenofen zum Kochen gebracht. Nach einer kurzen Abkühlzeit wurde das geschmolzene Gel in eine Minigel-Gießschale mit eingesetztem Kamm gegossen. Nach dem Abbinden wurden die Gele 60 min bei 60 V in ihren jeweiligen Elektrolyten laufen gelassen, um die Beibehaltung von Form und Konsistenz zu überprüfen.

Nur Elektrolytlösungen mit basischem pH-Wert sind geeignet, da die Verwendung von Lösungen mit saurem pH-Wert das Abbinden von Agargelen zu stören schien, was zu sehr weichen und klebrigen Gelen führte (Daten nicht gezeigt). Tabelle IV zeigt die Eigenschaften der getesteten Gel-Elektrolyt-Kombinationen. Im Allgemeinen wurde festgestellt, dass Kaliumhydroxid zur Verwendung bei der Gelelektrophorese ungeeignet war, da die mit diesem Elektrolyten hergestellten Gele dazu neigen, Farbstiche und eine weiche, klebrige Textur aufzuweisen, die die Form der Vertiefungen nicht beibehält.

Elektrolyt Agar-Agar (Marke Swallow Globe) Agar-Agar (Marke Rose) Konnyaku-Gelee (Marke Red Man) Konnyaku-Gelee (Marke Jim Willie) Bakteriologischer Agar (Oxoid)
CH3COONa R R
NaHCO3 m m
N / A2HPO4 R R
K2HPO4 m m
KOH C C, A C, A C, A C
  • √ = für Elektrophorese geeignet A = Gel ist klebrig C = Gel hat eine Farbe und/oder erscheint trüb M = Gel schmilzt während der Elektrophorese R = Gel bindet zu schnell ab.

Auch Gele auf Konnyaku-Basis waren ungeeignet, da solche mit Na2HPO4 und CH3COONa würde zu schnell abbinden, um das Plattengel richtig zu gießen, während diejenigen mit K2HPO4 und NaHCO3 neigen dazu, während der Elektrophorese zu schmelzen. Es wurde beobachtet, dass während der Elektrophorese der Stromfluss und die Leitfähigkeit durch den Tank mit Gelen auf Konnyaku-Basis höher waren als bei Gelen, die entweder aus Agar oder Agarose hergestellt wurden, möglicherweise weil die kommerziellen Konnyaku-Pulvermischungen Verbindungen enthalten, die in den Elektrolyten im Tank ausgelaugt wurden. wodurch die Leitfähigkeit erhöht wird.

Elektrophorese von Farbstoffen in ausgewählten Gel-Elektrolyt-Kombinationen

Eine Reihe von Farbstoffen wurde für die Verwendung in der Elektrophorese ausgewählt, basierend auf ihrer Stabilität in den Elektrolyten, die in den Elektrophoresetanks verwendet werden sollen. Dies waren Xylolcyanol FF, Methylorange, Kresolrot, Bromphenolblau, Orange G und Ponceau S. Die Wanderung jedes Farbstoffs wurde nach 60-minütiger Elektrophorese bei 60 V in einem Minigel aufgezeichnet. Die Farbstoffe wurden einzeln und als Mischung aller sechs Farbstoffe zusammen auf Gel-Elektrolyt-Kombinationen, die in Tabelle IV als geeignet identifiziert wurden, getestet. Die Farbstoffmischung trennt sich während der Elektrophorese in einem Agarose-FSME-Gel sauber und scheint während der Elektrophorese nicht zu reagieren oder miteinander zu interagieren (Daten nicht gezeigt).

Abb. 2 zeigt die zurückgelegte Strecke des Panels von sechs negativ geladenen Farbstoffen in Gelen aus 1% Agar-Agar (Marke Swallow Globe) in den ausgewählten Elektrolyten. Die von den Farbstoffen gewanderte Distanz war in jedem Elektrolyten leicht unterschiedlich und schien mit dem pH-Wert zu variieren. Gele, die aus Agar-Agar der Marke Rose und bakteriologischem Agar hergestellt wurden, zeigten ähnliche Ergebnisse (Daten nicht gezeigt). Im Allgemeinen wanderten die Farbstoffe umso weiter, je höher der pH-Wert des Elektrolyten ist. In allen vier verwendeten Elektrolyten wanderte Kresolrot mit Bromphenolblau, während Kresolrot in FSME-Puffer weniger wandern würde als Bromphenolblau (siehe Abb. 1 und Tabelle I). Dies scheint nicht pH-abhängig zu sein, da der pH-Wert von FSME bei 8,0 liegt, ein Wert zwischen dem von CH3COONa und NaHCO3.

Simulation von DNA-Gelelektrophorese

Die Gelelektrophorese von DNA-Proben wird typischerweise in einem horizontalen „Untersee“-Agarose-Gel durchgeführt, das in einen leitfähigen Puffer eingetaucht ist. Wenn Strom durch die Pufferlösung im Elektrophoresetank geleitet wird, wird ein elektrisches Feld erzeugt. Die Phosphatgruppen in der DNA sind negativ geladen, wodurch das DNA-Molekül insgesamt negativ geladen ist. In einem elektrischen Feld bewegt sich die DNA in Richtung der positiv geladenen Elektrode (Anode) der Elektrophoresekammer [1].

DNA-Fragmente werden nach Größe getrennt, da kleinere Fragmente weiter durch die Poren der Gelmatrix wandern als größere Fragmente. Die migrierte Distanz ist umgekehrt proportional zum log10 des Molekulargewichts des DNA-Fragments. Die Migrationsgeschwindigkeit wird durch die über das Gel angelegte Feldstärke bestimmt. Die Stärke eines elektrischen Feldes ist direkt proportional zur Potentialdifferenz (angelegte Spannung) und umgekehrt proportional zur Länge des elektrischen Feldes [ 4 , 5 ]. Eine Erhöhung der Spannung oder eine Verringerung des Abstands zwischen den Elektroden kann die Feldstärke erhöhen und somit die Geschwindigkeit der DNA-Fragmentmigration erhöhen. Je höher die angelegte Spannung ist, desto größer ist jedoch der Strom, der durch den Elektrophoresetank fließt, was zu einer Wärmeentwicklung führt, die das Gel schmelzen könnte [ 4 , 5 ].

Nach der Elektrophorese wird das Agarosegel dann mit Ethidiumbromid gefärbt. Ethidiumbromid bindet an DNA-Moleküle und fluoresziert unter UV-Licht, wodurch die Position der „Banden“ der DNA sichtbar wird [ 1 , 2 ]. Auf dem Gel kann neben DNA-Proben auch eine „DNA-Leiter“ (Marker) mitgeführt werden, die aus DNA-Fragmenten bekannter Größe besteht. Die Größe eines unbekannten Probenfragments kann durch Vergleich seiner migrierten Distanz mit der der DNA-Fragmente in der Leiter bestimmt werden [1, 4, 5].

Die hier vorgestellten Ersatzmaterialien können ganz oder teilweise verwendet werden, um DNA-Gelelektrophorese für den Einsatz in Lehranwendungen zu simulieren. Es sollten jedoch einige Punkte beachtet werden, um das konzeptionelle Verständnis der Studierenden für die beteiligten Prozesse zu fördern. Es sollte darauf geachtet werden, dass die Farbigkeit der Farbersatzstoffe die Schüler nicht verwirrt und zu Missverständnissen führt. Es ist zum Beispiel wichtig zu betonen, dass die Farbe nicht die „Größe“ des simulierten DNA-Fragments bestimmt und dass sich die Verwendung von Farbstoffen hier von der Färbung von DNA zum Zwecke der Visualisierung unterscheidet.

Ein weiterer wichtiger Punkt ist, dass das Molekulargewicht eines Farbstoffs nicht allein die im Gel gewanderte Distanz bestimmt. Im Gegensatz zu DNA können die Farbstoffverbindungen relativ zueinander unterschiedliche Ladungsdichten aufweisen. Daher steht das Molekulargewicht des Farbstoffs nicht in direktem Zusammenhang mit der scheinbaren „Größe“ der simulierten DNA-Bande, die durch den Farbstoff gebildet wird.

Für Anwendungen, bei denen die farbstoffbasierte Gelelektrophorese die DNA-Gelelektrophorese simulieren soll, um die Molekülgröße „unbekannter DNA-Fragmente“ zu bestimmen, indem eine Standardkurve der migrierten Distanz gegen das Molekulargewicht der „bekannten DNA-Fragmente“ erstellt wird. die nominelle "Größe" jeder Bande ist in Tabelle I angegeben. Die scheinbare "Größe" jedes Farbstoffs wurde aus einer Standardkurve abgeschätzt, die aus den Distanzen erzeugt wurde, die von DNA-Fragmenten einer Standard-DNA-Leiter gewandert wurden.

Diese Werte können in Verbindung mit der gemessenen Wanderung der jeweiligen Farbstoffe in Schülerexperimenten verwendet werden, um eine Standardkurve zu erstellen, die verwendet werden kann, um beispielsweise die „Größe“ eines Farbstoffs abzuschätzen, der nicht im Ladder-Mix enthalten ist. Beachten Sie, dass die Werte für Gelkonzentrationen von (1,0 ± 0,2)% einigermaßen genau sind.

Improvisierte Gelelektrophorese

Soweit verfügbar, bieten kommerzielle Elektrophoresegeräte die konsistentesten und sichersten Gelläufe an. Ansonsten ist das Improvisieren mit leicht verfügbaren Materialien relativ einfach und Protokolle sind verfügbar [8,9]. Gießen Sie das Gel in einen kleinen Lebensmittelbehälter aus Polypropylen, der dann verwendet wird vor Ort für die Elektrophorese [ 8 ], ist besonders effektiv.

Eine nützliche Verbesserung des beschriebenen Designs besteht darin, das Gel mit einem "Kamm" zu gießen, um Vertiefungen zu erzeugen, um die zu ladenden Farbstoffproben aufzunehmen, anstatt farbstoffgetränkte Filterpapierstreifen zu verwenden, die direkt in das Gel eingeführt werden. Der Kamm kann einem vorhandenen Elektrophorese-Set entnommen oder durch Einschneiden von Schlitzen in ein Stück 1–1,5 mm dicke Plastikfolie hergestellt werden. Obwohl dies einen höheren Aufwand erfordert, um den Kamm während des Gießens zu positionieren und zu stützen, erscheinen die Farbbänder besser definiert mit weniger Verschmieren, wenn sie in Vertiefungen geladen werden.

Wir empfehlen außerdem, das Setup zu verbessern, indem Sie für die Elektroden Kohlestäbe mit einem Durchmesser von 4–5 mm verwenden. Elektroden aus Platin oder Edelstahl sind wegen ihrer Korrosionsbeständigkeit vorzuziehen, jedoch handelt es sich hierbei um teure Spezialartikel. Häufig werden blanke Kupferdrähte verwendet [ 8 , 9 ], dies hat jedoch den Nachteil, dass farbige Niederschläge entstehen und dabei korrodiert werden. Carbonstäbe haben eine höhere Beständigkeit, korrodieren aber nicht und können wiederverwendet werden.

An das Ende jedes Kohlenstoffstabes wurde ein Kupferdraht mit einer Krokodilklemme geklemmt. Die Krokodilklemme und das Ende des Kohlestabs wurden mit Labor-Dichtungsfolie („Parafilm“) fest umwickelt, um zu verhindern, dass das Metall der Klemme mit der Elektrolytlösung in Kontakt kommt. Nach dem Gießen des Gels in den Lebensmittelbehälter (∼15 cm x 10 cm oder 6" x 4") wurde das Gel parallel zu den Längsseiten des Behälters etwa 2 cm von der Wand entfernt und die Gelstreifen an beiden Enden wurden herausgehoben. Legen Sie einen Kohlestab in jede der beiden erstellten Mulden, so dass sie parallel zueinander sind, aber mit den angebrachten elektrischen Drähten an den gegenüberliegenden Enden. Auf diese Weise angeordnet, geht ein einigermaßen gleichmäßiges elektrisches Feld durch den zentralen Teil des Gels, was eine effektive elektrophoretische Trennung von Farbstoffen bei 12 V innerhalb von 60 min ermöglicht (siehe Abb. 3).

Selbstgebautes Gerät zur improvisierten Gelelektrophorese. 1% Agar-Agar-Gel, 10 mM Natriumbicarbonat-Elektrolytlösung. Etwa 7,5 µl jeder Farbstofflösung werden pro Well geladen und 60 min mit 12 V angelegt. Alle Farbstoffe in 20 % Glycerinlösung. Fahrspuren (von links nach rechts): 0,1% Xylolcyanol FF, 0,1% Bromphenolblau, 0,2% Orange G, 0,1% Ponceau S. Die nächsten vier Bahnen werden wiederholt. Die Feldstärke in dieser selbstgebauten Kammer beträgt ∼2 V cm -1 .

Aus Sicherheitsgründen und zur Minimierung der Hitzeentwicklung innerhalb des kleinen Behälters sollten nur Niederspannungen (<24 V) verwendet werden. Allzweck-Transformatoren mit 12 V DC (200–500 mA) sind leicht erhältlich und für diese Verwendung geeignet. Es wurde ein Stromfluss im Bereich von 12–20 mA festgestellt. Wenn zur Beschleunigung des Prozesses höhere Spannungen zwischen 12 und 24 V gewünscht werden und keine geeigneten Labornetzteile zur Verfügung stehen, können die Netzteile für Computer-Notebooks eingesetzt werden, da viele von ihnen eine Ausgangsspannung in diesem Bereich haben. In jedem Fall ist darauf zu achten, dass Kurzschlüsse vermieden werden, z. B. dass die Elektroden nicht miteinander in Kontakt kommen.

Die Migration von Farbstoffen innerhalb der niedrigen Feldstärke des improvisierten Tanks ist langsam. Daher sind die am besten zu verwendenden Farbstoffe diejenigen, die am schnellsten wandern, um die Zeit zu minimieren, die benötigt wird, um klar getrennte Banden zu sehen. Ponceau S, Orange G und Bromphenolblau wandern am schnellsten, während Xylolcyanol FF als vierter Farbstoff nützlich ist, da es am langsamsten wandert. Alle vier Farbstoffe zusammen bilden einen bunten, gut getrennten Satz von Bändern.

Klassenzimmeraktivitäten mit farbstoffbasierter Gelelektrophorese

Bestimmung der Größe unbekannter DNA-Fragmente – Eine der alltäglichen Anwendungen der DNA-Gelelektrophorese in Forschungslabors ist die Analyse von DNA-Fragmenten, die bei einem Experiment wie der Polymerase-Kettenreaktion (PCR)-Amplifikation oder der Extraktion von Plasmid-DNA aus Bakterien erzeugt wurden. Die Bestimmung der Größe des DNA-Fragments ist eine grundlegende Technik und kann leicht simuliert werden, indem eine „Farbleiter“ erstellt und ein oder zwei weitere Farbstoffe als „unbekannte DNA“ verwendet werden.

Die für die Leiter ausgewählten Farbstoffe sollten gut getrennt sein. Die Farbstoffleiter sollte von Grund auf neu erstellt werden und nicht durch einfaches Mischen mehrerer Farbstoffe, was zu einer Verdünnung der einzelnen Farbstoffe führen würde. Die für die Leiter ausgewählten Farbstoffe sollten abgewogen und dann in dieselbe Flasche gegeben werden, bevor das gleiche Volumen an 20% Glycerinlösung hinzugefügt wird, als ob es nur ein einzelner Farbstoff wäre.

Die „unbekannte DNA“-Probe sollte idealerweise ein Farbstoff sein, der nicht zu denen gehört, die im DNA-Leiter-Mix enthalten sind. Die Schüler können dann Gele mit dem Ladder-Mix und der unbekannten Probe laufen lassen, ein Diagramm der Standardkurve unter Verwendung der in Tabelle I angegebenen nominellen „bp-Größe“-Werte erstellen und dann das Diagramm verwenden, um die Größe der unbekannten Probe abzuschätzen [ 1 ].

DNA-Fingerabdruck-Methode – Die vielleicht einfachste und wahrscheinlich gebräuchlichste Anwendung der farbstoffbasierten Gelelektrophorese wäre die Simulation des „forensischen DNA-Fingerabdrucks“. Dies kann erreicht werden, indem mehrere Variationen von Farbstoffmischungen hergestellt werden, die das DNA-Profil mehrerer "Verdächtiger" darstellen, und eine doppelte Präparation von einer davon als "Tatort-DNA"-Probe zuordnen. Eine Variante davon wäre, die Verdächtigen mit einer einzigartigen „Tatort-DNA“ -Probe zu entlasten.

Genotyp-Identifikation – Ein beliebtes PCR-basiertes Experiment, das im Unterricht verwendet wird, besteht darin, den Genotyp jedes Schülers in der Klasse an einem bestimmten Ort zu bestimmen, wie z Alu PV92 [ 1 ]. Der Genotyp wird unter Verwendung von Agarosegelelektrophorese für das Vorhandensein einer oder beider DNA-Banden sichtbar gemacht. Jede Bande repräsentiert eines von zwei möglichen Allelen für das Gen oder den Locus. Diese Übung kann auch verwendet werden, um Konzepte der Vererbung und der Populationsgenetik zu vermitteln. Gepaarte Farbstoffe ähnlicher Farbe, wie Methylorange und Orange G, Kresolrot und Ponceau S, oder die kationischen Farbstoffe Brillantgrün und Methylgrün könnten verwendet werden, um die beiden allelischen Formen der DNA zu simulieren, die in einem solchen Experiment amplifiziert wurden viele der wichtigsten Lehrpunkte abdecken, ohne dass PCR erforderlich ist.

Abgesehen von den bereits erwähnten Standardübungen der DNA-Wissenschaft könnte die farbstoffbasierte Gelelektrophorese auch als System zur Anleitung des forschenden Lernens verwendet werden, bei dem die Schüler beispielsweise den Einfluss der Gelkonzentration oder der Feldstärke auf die zurückgelegte Entfernung untersuchen könnten. Andere haben auch die Verwendung von sowohl kationischen als auch anionischen Farbstoffen auf demselben Gel (wobei die Beladungsmulden in der Mitte des Gels gebildet werden) vorgeschlagen, um die Diskussion mit physikalisch-wissenschaftlichen Konzepten wie dem Einfluss der Ladung auf die Migrationsrichtung in Verbindung zu bringen ein elektrisches Feld [ 7 ] (siehe Abb. 4).

Beispiele für geladene Farbstoffe. Strukturen von zwei Beispielfarbstoffen. Orange G ist ein anionischer oder negativ geladener Farbstoff. Pyronin Y (auch Pyronin G genannt) ist ein kationischer, positiv geladener Farbstoff [12].


Protokolle

Teil 1: Laufen Sie Ihr Gel

  1. Fügen Sie den M13KO7-Proben vom letzten Mal 2,5 µl Ladefarbstoff hinzu. Der Ladefarbstoff enthält Xylolcyanol als Tracking-Farbstoff, um den Fortschritt der Elektrophorese zu verfolgen (damit Sie nicht die kleinsten Fragmente vom Ende Ihres Gels laufen lassen!) sowie Glycerin, damit die Proben in die Vertiefung einsinken.
  2. Schwenken Sie die Eppendorf-Röhrchen, um den Inhalt zu mischen, und drehen Sie sie dann schnell in der Mikrozentrifuge, um den Inhalt der Röhrchen auf den Boden zu bringen.
  3. Laden Sie das Gel in der in der folgenden Tabelle angegebenen Reihenfolge. Eine Gruppe wird in die Wells 1 bis 3 geladen, eine andere Gruppe wird in die Wells 5 bis 7 geladen. Um Ihre Proben zu laden, ziehen Sie 25 &mgr;l in die Spitze Ihres P200. Senken Sie die Spitze unter die Oberfläche des Puffers und direkt über die Vertiefung. Sie riskieren, den Boden der Vertiefung zu durchstechen, wenn Sie die Spitze zu weit in die Vertiefung selbst absenken (durchbohren = schlecht!). Geben Sie Ihre Probe in den Brunnen. Lassen Sie den Pipettenkolben erst los, nachdem Sie die Spitze aus der Gelbox entfernt haben (sonst ziehen Sie Ihre Probe zurück in die Spitze!).
  4. Nachdem alle Proben geladen wurden, schließen Sie die Gelbox an die Stromversorgung an und lassen Sie das Gel nicht länger als 45 Minuten bei 125 V laufen.
  5. Ihnen wird gezeigt, wie Sie Ihr Gel fotografieren und die relevanten DNA-Banden ausschneiden.
Bahnen, Samples und Volumina zum Laden.
LANES PROBEN LADEVOLUMEN
1 1 kb Markierung 5 &mikrol
2 M13KO7 ungeschnittene Probe Gesamtes Reaktionsvolumen (

Ein Gel laden. (Abbildung von MIT OpenCourseWare.)

Teil 2: DNA isolieren/reinigen

Um Ihre DNA von der Agarose zu reinigen, verwenden Sie ein von Qiagen verkauftes Kit. Die Reagenzien haben nicht aussagekräftige Namen und ihr Inhalt ist urheberrechtlich geschützt. Das Agarose Purification Kit erfordert das Binden der DNA an eine Spin-Säule mit einer Silicagel-Membran, das Wegwaschen von Salzen und das Eluieren der DNA von der Membran.

  1. 550 µl hinzufügen QG zu deinem Stück Agarose.
  2. 10 Minuten bei 50°C inkubieren, bis die Agarose vollständig aufgelöst ist. Alle paar Minuten können Sie Ihre Tube von der 50°C Hitze nehmen, um den Inhalt zu schleudern. Dies hilft, die Agarose aufzulösen.
  3. Fügen Sie Ihrem Eppendorf-Röhrchen 125 &mgr;l Isopropanol hinzu.
  4. Besorgen Sie sich eine QIAquick-Spin-Säule (lila) mit Sammelröhrchen (transparent) vom Lehrpersonal. Beschriften Sie die Spinsäule (nicht das Sammelröhrchen!) und pipettieren Sie dann die gelöste Agarosemischung oben in die Säule. Die Säule im Sammelröhrchen 60 Sekunden lang mikrofugieren. Die maximale Kapazität der QIAquick-Säulen beträgt 800 µl! If you have more than 800 µl in your mixture, you will need to repeat this step.
  5. Discard the flow-through in the sink and replace the spin-column in its collection tube. Add 750 µl of PE to the top of the column and spin as before.
  6. Discard the flow-through in the sink and replace the spin-column in the collection tube. Add nothing to the top but spin for 60 seconds more to dry the membrane.
  7. Trim the cap off a new eppendorf tube and label the side with your team color and the date. Place the spin-column in the trimmed eppendorf tube and add 30 µl of EB to the center of the membrane.
  8. Allow the column to sit at room temperature for one minute and then spin as before. The material that collects in the bottom of the eppendorf tube is your purified plasmid backbone, ready to be ligated. Give it to the teaching faculty who will store it with your insert until next time.

Part 3: Titering Phage

One technique you will see several times this term is plating for plaques. The idea of this technique is simple. Since phage infection slows down the growth of bacteria, any phage-infected cell will grow less quickly than an uninfected one, giving rise to a zone that is more clear on a lawn of fully grown cells. This zone is called a plaque and by counting the number of plaques formed, it is possible to measure the number of infective phage in the sample you are testing. The number of infected phages is measured as PFUs, which is "plaque forming units per ml."

Plaques formed by bacteriophage upon infection of susceptible bacteria. Source: Assorted Views of Bacteriophage Plaques. © Quiroz. Licensed for use, ASM MicrobeLibrary.

  1. Start by placing 6 LB plates in the 37° incubator to prewarm them. If there is any condensation on the surface of the plates, then you can leave the lids slightly ajar to dry the plate surface.
  2. Aliquot 200 µl of bacteria into 6 small, sterile test tubes. The bacteria you are using are the strain ER2267 since this strain has a selectible F'. Label the tops of each tube with a colored sticker and one of the following: none, none, 10 -4 E4, 10 -6 E4, 10 -4 K07, 10 -6 K07.
  3. The teaching faculty have two phage stocks for you to compare, an M13KO7 phage stock and a stock of another M13 phage called E4. You will need to serially dilute each stock, making stepwise 1/100 dilutions in eppendorf tubes. For example, add 10 µl of a phage stock to 990 µl sterile water for a 10 -2 dilution, then repeat, using 10 µl of the 10 -2 dilution into 990 µl sterile water to make a 10 -4 dilution. Vortex the dilutions before removing any liquid and change pipet tips to prepare each new dilution. Continue serially diluting the phage to final concentrations that are 10 -4 th and 10 -6 th as concentrated as the starting stock.
  4. Mix 10 µl of one of the 10 -4 dilutions into a tube with bacteria.
  5. Mix 10 µl of one of the 10 -6 dilution into another tube with bacteria.
  6. Repeat with the dilutions of the other phage stock.
  7. One of the teaching faculty will show you how to mix 3 ml of top agar into one of the uninfected samples you have prepared and how to pour the molten mix onto the surface of a prewarmed LB plate.
  8. You and your partner should add top agar to the other uninfected sample and the four phage infected ones.

Allow the top agar to solidify by leaving the plates on the bench at least 5 minutes then stack them and wrap them with your colored tape and finally move them to the 37° incubator to grow overnight. One of the teaching faculty will remove them from the incubator tomorrow and store them for you until next time.


Principle:

The negatively charged DNA molecules migrate towards the positive charge under the influence of constant current, thus the separation depends on the mass and charge of DNA. The DNA molecules are forced to move through the agarose gel pores. The rate of the migration depends on,

      • The strength of the field
      • The hydrophobicity of the DNA
      • The ionic strength of the buffer
      • The size and shape of the DNA
      • The temperature of the buffer

      Three of the important factors that affect DNA migration rate are,

      As we discussed earlier if the concentration of agarose is lower, the DNA can migrate easily and faster and vice versa.

      The supercoiled DNA migrates faster than the linear DNA and circular DNA.

      The supercoiled form of DNA is more compact than other forms and this is the reason for its speedy migration.

      If the size of a DNA is larger, the migration rate of it is lower and therefore PCR product of several hundred base pairs migrates faster than the total genomic DNA.


      When is gel electrophoresis used to separate DNA fragments?

      Gel electrophoresis can be used for a range of purposes, for example:

      • To get a DNA fingerprint for forensic purposes
      • To get a DNA fingerprint for paternity testing
      • To get a DNA fingerprint so that you can look for evolutionary relationships among organisms
      • To check a PCR reaction.
        See the video clip: Using gel electrophoresis to check a PCR reaction
      • To test for genes associated with a particular disease.
        Find out more in the article, Gel electrophoresis can be used to find genes associated with a disease.

      Now this image is pretty good but what is the problem?

      Here the annealing temperature of the primer is not selected properly. So the primer is compromised with other complementary sequences present in the genome. The annealing temperature is too low in comparison with its actual annealing temperature.

      Due to this reason, more than 4 bands of PCR amplicons are observed in the gel. Further, see the green arrow, a bubble hindered the separation of the DNA ladder.

      Conclusively, the PCR is not performed with the optimum PCR conditions.


      SYBR Green

      The SYBR Green I and II stains (again, marketed by Molecular Probes) are optimized for different purposes. Because they bind to DNA, they are still considered potential mutagens and because of that, they should be handled with care.

      SYBR Green I is more sensitive for use with double-stranded DNA, while SYBR Green II, on the other hand, is best for use with single-stranded DNA or RNA. Like the popular ethidium bromide stain, these highly sensitive stains fluoresce under UV light.

      Both SYBR Green I and II are recommended by the manufacturer to be used with "254 nm epi-illumination Polaroid 667 black and white film and a SYBR Green gel stain photographic filter" to achieve detection of 100 pg of RNA or single-strand DNA per band.


      Successful DNA Plasmid Preps

      Although DNA plasmid preps can return multiple forms of DNA, there is only one kind you want for successful cloning and transfection: supercoiled. Make sure you know how to increase your recovery of good quality supercoiled DNA. Did this help you understand why you get three bands when running plasmid DNA on agarose gels? Do you have any other plasmid prep tips? We’d love to hear in the comments.

      Originally published October 8, 2014. Reviewed and republished April 2021.


      Schau das Video: Gel Electrophoresis (Juni 2022).


Bemerkungen:

  1. Ida

    Ja in der Tat. Es war auch bei mir. Wir können über dieses Thema kommunizieren. Hier oder bei PM.

  2. Fern

    Ich kenne noch eine Entscheidung

  3. Nealon

    Ich weiß genau, dass dies ein Fehler ist.

  4. Riccardo

    Wenn sie sagen, sie sind auf dem falschen Track.



Eine Nachricht schreiben